Data items in the ATOM_SITE category record details about
the atom sites in a macromolecular crystal structure, such as
the positional coordinates, atomic displacement parameters,
magnetic moments and directions, and so on.
The data items for describing anisotropic temperature or atomic
displacement factors are only used if the corresponding items
are not given in the ATOM_SITE_ANISOTROP category.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:atom_siteCategory>
<PDBx:atom_site id="1">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>N</PDBx:type_symbol>
<PDBx:label_atom_id>N</PDBx:label_atom_id>
<PDBx:label_comp_id>VAL</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>11</PDBx:label_seq_id>
<PDBx:label_alt_id xsi:nil="true" />
<PDBx:Cartn_x>25.369</PDBx:Cartn_x>
<PDBx:Cartn_y>30.691</PDBx:Cartn_y>
<PDBx:Cartn_z>11.795</PDBx:Cartn_z>
<PDBx:occupancy>1.00</PDBx:occupancy>
<PDBx:B_iso_or_equiv>17.93</PDBx:B_iso_or_equiv>
<PDBx:auth_seq_id>11</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="2">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:label_atom_id>CA</PDBx:label_atom_id>
<PDBx:label_comp_id>VAL</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>11</PDBx:label_seq_id>
<PDBx:label_alt_id xsi:nil="true" />
<PDBx:Cartn_x>25.970</PDBx:Cartn_x>
<PDBx:Cartn_y>31.965</PDBx:Cartn_y>
<PDBx:Cartn_z>12.332</PDBx:Cartn_z>
<PDBx:occupancy>1.00</PDBx:occupancy>
<PDBx:B_iso_or_equiv>17.75</PDBx:B_iso_or_equiv>
<PDBx:auth_seq_id>11</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="3">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:label_atom_id>C</PDBx:label_atom_id>
<PDBx:label_comp_id>VAL</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>11</PDBx:label_seq_id>
<PDBx:label_alt_id xsi:nil="true" />
<PDBx:Cartn_x>25.569</PDBx:Cartn_x>
<PDBx:Cartn_y>32.010</PDBx:Cartn_y>
<PDBx:Cartn_z>13.808</PDBx:Cartn_z>
<PDBx:occupancy>1.00</PDBx:occupancy>
<PDBx:B_iso_or_equiv>17.83</PDBx:B_iso_or_equiv>
<PDBx:auth_seq_id>11</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="4">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>O</PDBx:type_symbol>
<PDBx:label_atom_id>O</PDBx:label_atom_id>
<PDBx:label_comp_id>VAL</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>11</PDBx:label_seq_id>
<PDBx:label_alt_id xsi:nil="true" />
<PDBx:Cartn_x>24.735</PDBx:Cartn_x>
<PDBx:Cartn_y>31.190</PDBx:Cartn_y>
<PDBx:Cartn_z>14.167</PDBx:Cartn_z>
<PDBx:occupancy>1.00</PDBx:occupancy>
<PDBx:B_iso_or_equiv>17.53</PDBx:B_iso_or_equiv>
<PDBx:auth_seq_id>11</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="5">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:label_atom_id>CB</PDBx:label_atom_id>
<PDBx:label_comp_id>VAL</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>11</PDBx:label_seq_id>
<PDBx:label_alt_id xsi:nil="true" />
<PDBx:Cartn_x>25.379</PDBx:Cartn_x>
<PDBx:Cartn_y>33.146</PDBx:Cartn_y>
<PDBx:Cartn_z>11.540</PDBx:Cartn_z>
<PDBx:occupancy>1.00</PDBx:occupancy>
<PDBx:B_iso_or_equiv>17.66</PDBx:B_iso_or_equiv>
<PDBx:auth_seq_id>11</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="6">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:label_atom_id>CG1</PDBx:label_atom_id>
<PDBx:label_comp_id>VAL</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>11</PDBx:label_seq_id>
<PDBx:label_alt_id xsi:nil="true" />
<PDBx:Cartn_x>25.584</PDBx:Cartn_x>
<PDBx:Cartn_y>33.034</PDBx:Cartn_y>
<PDBx:Cartn_z>10.030</PDBx:Cartn_z>
<PDBx:occupancy>1.00</PDBx:occupancy>
<PDBx:B_iso_or_equiv>18.86</PDBx:B_iso_or_equiv>
<PDBx:auth_seq_id>11</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="7">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:label_atom_id>CG2</PDBx:label_atom_id>
<PDBx:label_comp_id>VAL</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>11</PDBx:label_seq_id>
<PDBx:label_alt_id xsi:nil="true" />
<PDBx:Cartn_x>23.933</PDBx:Cartn_x>
<PDBx:Cartn_y>33.309</PDBx:Cartn_y>
<PDBx:Cartn_z>11.872</PDBx:Cartn_z>
<PDBx:occupancy>1.00</PDBx:occupancy>
<PDBx:B_iso_or_equiv>17.12</PDBx:B_iso_or_equiv>
<PDBx:auth_seq_id>11</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="8">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>N</PDBx:type_symbol>
<PDBx:label_atom_id>N</PDBx:label_atom_id>
<PDBx:label_comp_id>THR</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>12</PDBx:label_seq_id>
<PDBx:label_alt_id xsi:nil="true" />
<PDBx:Cartn_x>26.095</PDBx:Cartn_x>
<PDBx:Cartn_y>32.930</PDBx:Cartn_y>
<PDBx:Cartn_z>14.590</PDBx:Cartn_z>
<PDBx:occupancy>1.00</PDBx:occupancy>
<PDBx:B_iso_or_equiv>18.97</PDBx:B_iso_or_equiv>
<PDBx:footnote_id>4</PDBx:footnote_id>
<PDBx:auth_seq_id>12</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="9">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:label_atom_id>CA</PDBx:label_atom_id>
<PDBx:label_comp_id>THR</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>12</PDBx:label_seq_id>
<PDBx:label_alt_id xsi:nil="true" />
<PDBx:Cartn_x>25.734</PDBx:Cartn_x>
<PDBx:Cartn_y>32.995</PDBx:Cartn_y>
<PDBx:Cartn_z>16.032</PDBx:Cartn_z>
<PDBx:occupancy>1.00</PDBx:occupancy>
<PDBx:B_iso_or_equiv>19.80</PDBx:B_iso_or_equiv>
<PDBx:footnote_id>4</PDBx:footnote_id>
<PDBx:auth_seq_id>12</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="10">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:label_atom_id>C</PDBx:label_atom_id>
<PDBx:label_comp_id>THR</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>12</PDBx:label_seq_id>
<PDBx:label_alt_id xsi:nil="true" />
<PDBx:Cartn_x>24.695</PDBx:Cartn_x>
<PDBx:Cartn_y>34.106</PDBx:Cartn_y>
<PDBx:Cartn_z>16.113</PDBx:Cartn_z>
<PDBx:occupancy>1.00</PDBx:occupancy>
<PDBx:B_iso_or_equiv>20.92</PDBx:B_iso_or_equiv>
<PDBx:footnote_id>4</PDBx:footnote_id>
<PDBx:auth_seq_id>12</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="11">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>O</PDBx:type_symbol>
<PDBx:label_atom_id>O</PDBx:label_atom_id>
<PDBx:label_comp_id>THR</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>12</PDBx:label_seq_id>
<PDBx:label_alt_id xsi:nil="true" />
<PDBx:Cartn_x>24.869</PDBx:Cartn_x>
<PDBx:Cartn_y>35.118</PDBx:Cartn_y>
<PDBx:Cartn_z>15.421</PDBx:Cartn_z>
<PDBx:occupancy>1.00</PDBx:occupancy>
<PDBx:B_iso_or_equiv>21.84</PDBx:B_iso_or_equiv>
<PDBx:footnote_id>4</PDBx:footnote_id>
<PDBx:auth_seq_id>12</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="12">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:label_atom_id>CB</PDBx:label_atom_id>
<PDBx:label_comp_id>THR</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>12</PDBx:label_seq_id>
<PDBx:label_alt_id xsi:nil="true" />
<PDBx:Cartn_x>26.911</PDBx:Cartn_x>
<PDBx:Cartn_y>33.346</PDBx:Cartn_y>
<PDBx:Cartn_z>17.018</PDBx:Cartn_z>
<PDBx:occupancy>1.00</PDBx:occupancy>
<PDBx:B_iso_or_equiv>20.51</PDBx:B_iso_or_equiv>
<PDBx:footnote_id>4</PDBx:footnote_id>
<PDBx:auth_seq_id>12</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="13">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>O</PDBx:type_symbol>
<PDBx:label_atom_id>OG1</PDBx:label_atom_id>
<PDBx:label_comp_id>THR</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>12</PDBx:label_seq_id>
<PDBx:label_alt_id>3</PDBx:label_alt_id>
<PDBx:Cartn_x>27.946</PDBx:Cartn_x>
<PDBx:Cartn_y>33.921</PDBx:Cartn_y>
<PDBx:Cartn_z>16.183</PDBx:Cartn_z>
<PDBx:occupancy>0.50</PDBx:occupancy>
<PDBx:B_iso_or_equiv>20.29</PDBx:B_iso_or_equiv>
<PDBx:footnote_id>4</PDBx:footnote_id>
<PDBx:auth_seq_id>12</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="14">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>O</PDBx:type_symbol>
<PDBx:label_atom_id>OG1</PDBx:label_atom_id>
<PDBx:label_comp_id>THR</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>12</PDBx:label_seq_id>
<PDBx:label_alt_id>4</PDBx:label_alt_id>
<PDBx:Cartn_x>27.769</PDBx:Cartn_x>
<PDBx:Cartn_y>32.142</PDBx:Cartn_y>
<PDBx:Cartn_z>17.103</PDBx:Cartn_z>
<PDBx:occupancy>0.50</PDBx:occupancy>
<PDBx:B_iso_or_equiv>20.59</PDBx:B_iso_or_equiv>
<PDBx:footnote_id>4</PDBx:footnote_id>
<PDBx:auth_seq_id>12</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="15">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:label_atom_id>CG2</PDBx:label_atom_id>
<PDBx:label_comp_id>THR</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>12</PDBx:label_seq_id>
<PDBx:label_alt_id>3</PDBx:label_alt_id>
<PDBx:Cartn_x>27.418</PDBx:Cartn_x>
<PDBx:Cartn_y>32.181</PDBx:Cartn_y>
<PDBx:Cartn_z>17.878</PDBx:Cartn_z>
<PDBx:occupancy>0.50</PDBx:occupancy>
<PDBx:B_iso_or_equiv>20.47</PDBx:B_iso_or_equiv>
<PDBx:footnote_id>4</PDBx:footnote_id>
<PDBx:auth_seq_id>12</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="16">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:label_atom_id>CG2</PDBx:label_atom_id>
<PDBx:label_comp_id>THR</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>12</PDBx:label_seq_id>
<PDBx:label_alt_id>4</PDBx:label_alt_id>
<PDBx:Cartn_x>26.489</PDBx:Cartn_x>
<PDBx:Cartn_y>33.778</PDBx:Cartn_y>
<PDBx:Cartn_z>18.426</PDBx:Cartn_z>
<PDBx:occupancy>0.50</PDBx:occupancy>
<PDBx:B_iso_or_equiv>20.00</PDBx:B_iso_or_equiv>
<PDBx:footnote_id>4</PDBx:footnote_id>
<PDBx:auth_seq_id>12</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="17">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>N</PDBx:type_symbol>
<PDBx:label_atom_id>N</PDBx:label_atom_id>
<PDBx:label_comp_id>ILE</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>13</PDBx:label_seq_id>
<PDBx:label_alt_id xsi:nil="true" />
<PDBx:Cartn_x>23.664</PDBx:Cartn_x>
<PDBx:Cartn_y>33.855</PDBx:Cartn_y>
<PDBx:Cartn_z>16.884</PDBx:Cartn_z>
<PDBx:occupancy>1.00</PDBx:occupancy>
<PDBx:B_iso_or_equiv>22.08</PDBx:B_iso_or_equiv>
<PDBx:auth_seq_id>13</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="18">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:label_atom_id>CA</PDBx:label_atom_id>
<PDBx:label_comp_id>ILE</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>13</PDBx:label_seq_id>
<PDBx:label_alt_id xsi:nil="true" />
<PDBx:Cartn_x>22.623</PDBx:Cartn_x>
<PDBx:Cartn_y>34.850</PDBx:Cartn_y>
<PDBx:Cartn_z>17.093</PDBx:Cartn_z>
<PDBx:occupancy>1.00</PDBx:occupancy>
<PDBx:B_iso_or_equiv>23.44</PDBx:B_iso_or_equiv>
<PDBx:auth_seq_id>13</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="19">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:label_atom_id>C</PDBx:label_atom_id>
<PDBx:label_comp_id>ILE</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>13</PDBx:label_seq_id>
<PDBx:label_alt_id xsi:nil="true" />
<PDBx:Cartn_x>22.657</PDBx:Cartn_x>
<PDBx:Cartn_y>35.113</PDBx:Cartn_y>
<PDBx:Cartn_z>18.610</PDBx:Cartn_z>
<PDBx:occupancy>1.00</PDBx:occupancy>
<PDBx:B_iso_or_equiv>25.77</PDBx:B_iso_or_equiv>
<PDBx:auth_seq_id>13</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="20">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>O</PDBx:type_symbol>
<PDBx:label_atom_id>O</PDBx:label_atom_id>
<PDBx:label_comp_id>ILE</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>13</PDBx:label_seq_id>
<PDBx:label_alt_id xsi:nil="true" />
<PDBx:Cartn_x>23.123</PDBx:Cartn_x>
<PDBx:Cartn_y>34.250</PDBx:Cartn_y>
<PDBx:Cartn_z>19.406</PDBx:Cartn_z>
<PDBx:occupancy>1.00</PDBx:occupancy>
<PDBx:B_iso_or_equiv>26.28</PDBx:B_iso_or_equiv>
<PDBx:auth_seq_id>13</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="21">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:label_atom_id>CB</PDBx:label_atom_id>
<PDBx:label_comp_id>ILE</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>13</PDBx:label_seq_id>
<PDBx:label_alt_id xsi:nil="true" />
<PDBx:Cartn_x>21.236</PDBx:Cartn_x>
<PDBx:Cartn_y>34.463</PDBx:Cartn_y>
<PDBx:Cartn_z>16.492</PDBx:Cartn_z>
<PDBx:occupancy>1.00</PDBx:occupancy>
<PDBx:B_iso_or_equiv>22.67</PDBx:B_iso_or_equiv>
<PDBx:auth_seq_id>13</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="22">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:label_atom_id>CG1</PDBx:label_atom_id>
<PDBx:label_comp_id>ILE</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>13</PDBx:label_seq_id>
<PDBx:label_alt_id xsi:nil="true" />
<PDBx:Cartn_x>20.478</PDBx:Cartn_x>
<PDBx:Cartn_y>33.469</PDBx:Cartn_y>
<PDBx:Cartn_z>17.371</PDBx:Cartn_z>
<PDBx:occupancy>1.00</PDBx:occupancy>
<PDBx:B_iso_or_equiv>22.14</PDBx:B_iso_or_equiv>
<PDBx:auth_seq_id>13</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="23">
<PDBx:group_PDB>ATOM</PDBx:group_PDB>
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:label_atom_id>CG2</PDBx:label_atom_id>
<PDBx:label_comp_id>ILE</PDBx:label_comp_id>
<PDBx:label_asym_id>A</PDBx:label_asym_id>
<PDBx:label_seq_id>13</PDBx:label_seq_id>
<PDBx:label_alt_id xsi:nil="true" />
<PDBx:Cartn_x>21.357</PDBx:Cartn_x>
<PDBx:Cartn_y>33.986</PDBx:Cartn_y>
<PDBx:Cartn_z>15.016</PDBx:Cartn_z>
<PDBx:occupancy>1.00</PDBx:occupancy>
<PDBx:B_iso_or_equiv>21.75</PDBx:B_iso_or_equiv>
<PDBx:auth_seq_id>13</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="101">
<PDBx:group_PDB>HETATM</PDBx:group_PDB>
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:label_atom_id>C1</PDBx:label_atom_id>
<PDBx:label_comp_id>APS</PDBx:label_comp_id>
<PDBx:label_asym_id>C</PDBx:label_asym_id>
<PDBx:label_seq_id xsi:nil="true" />
<PDBx:label_alt_id>1</PDBx:label_alt_id>
<PDBx:Cartn_x>4.171</PDBx:Cartn_x>
<PDBx:Cartn_y>29.012</PDBx:Cartn_y>
<PDBx:Cartn_z>7.116</PDBx:Cartn_z>
<PDBx:occupancy>0.58</PDBx:occupancy>
<PDBx:B_iso_or_equiv>17.27</PDBx:B_iso_or_equiv>
<PDBx:footnote_id>1</PDBx:footnote_id>
<PDBx:auth_seq_id>300</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="102">
<PDBx:group_PDB>HETATM</PDBx:group_PDB>
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:label_atom_id>C2</PDBx:label_atom_id>
<PDBx:label_comp_id>APS</PDBx:label_comp_id>
<PDBx:label_asym_id>C</PDBx:label_asym_id>
<PDBx:label_seq_id xsi:nil="true" />
<PDBx:label_alt_id>1</PDBx:label_alt_id>
<PDBx:Cartn_x>4.949</PDBx:Cartn_x>
<PDBx:Cartn_y>27.758</PDBx:Cartn_y>
<PDBx:Cartn_z>6.793</PDBx:Cartn_z>
<PDBx:occupancy>0.58</PDBx:occupancy>
<PDBx:B_iso_or_equiv>16.95</PDBx:B_iso_or_equiv>
<PDBx:footnote_id>1</PDBx:footnote_id>
<PDBx:auth_seq_id>300</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="103">
<PDBx:group_PDB>HETATM</PDBx:group_PDB>
<PDBx:type_symbol>O</PDBx:type_symbol>
<PDBx:label_atom_id>O3</PDBx:label_atom_id>
<PDBx:label_comp_id>APS</PDBx:label_comp_id>
<PDBx:label_asym_id>C</PDBx:label_asym_id>
<PDBx:label_seq_id xsi:nil="true" />
<PDBx:label_alt_id>1</PDBx:label_alt_id>
<PDBx:Cartn_x>4.800</PDBx:Cartn_x>
<PDBx:Cartn_y>26.678</PDBx:Cartn_y>
<PDBx:Cartn_z>7.393</PDBx:Cartn_z>
<PDBx:occupancy>0.58</PDBx:occupancy>
<PDBx:B_iso_or_equiv>16.85</PDBx:B_iso_or_equiv>
<PDBx:footnote_id>1</PDBx:footnote_id>
<PDBx:auth_seq_id>300</PDBx:auth_seq_id>
</PDBx:atom_site>
<PDBx:atom_site id="104">
<PDBx:group_PDB>HETATM</PDBx:group_PDB>
<PDBx:type_symbol>N</PDBx:type_symbol>
<PDBx:label_atom_id>N4</PDBx:label_atom_id>
<PDBx:label_comp_id>APS</PDBx:label_comp_id>
<PDBx:label_asym_id>C</PDBx:label_asym_id>
<PDBx:label_seq_id xsi:nil="true" />
<PDBx:label_alt_id>1</PDBx:label_alt_id>
<PDBx:Cartn_x>5.930</PDBx:Cartn_x>
<PDBx:Cartn_y>27.841</PDBx:Cartn_y>
<PDBx:Cartn_z>5.869</PDBx:Cartn_z>
<PDBx:occupancy>0.58</PDBx:occupancy>
<PDBx:B_iso_or_equiv>16.43</PDBx:B_iso_or_equiv>
<PDBx:footnote_id>1</PDBx:footnote_id>
<PDBx:auth_seq_id>300</PDBx:auth_seq_id>
</PDBx:atom_site>
</PDBx:atom_siteCategory>
Equivalent isotropic atomic displacement parameter, B~equiv~,
in angstroms squared, calculated as the geometric mean of
the anisotropic atomic displacement parameters.
B~equiv~ = (B~i~ B~j~ B~k~)^1/3^
B~n~ = the principal components of the orthogonalised B^ij^
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The estimated standard deviation of
attribute B_equiv_geom_mean in category atom_site.
Isotropic temperature factor parameter, or equivalent isotropic
temperature factor, B~equiv~, calculated from anisotropic
temperature factor parameters.
B~equiv~ = (1/3) sum~i~[sum~j~(B~ij~ A~i~ A~j~ a*~i~ a*~j~)]
A = the real space cell lengths
a* = the reciprocal space cell lengths
B~ij~ = 8 pi^2^ U~ij~
Ref: Fischer, R. X. & Tillmanns, E. (1988). Acta Cryst. C44,
775-776.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The estimated standard deviation of attribute B_iso_or_equiv in category atom_site.
The x atom site coordinate in angstroms specified according to
a set of orthogonal Cartesian axes related to the cell axes as
specified by the description given in
attribute Cartn_transform_axes in category atom_sites.
The estimated standard deviation of attribute Cartn_x in category atom_site.
The y atom site coordinate in angstroms specified according to
a set of orthogonal Cartesian axes related to the cell axes as
specified by the description given in
attribute Cartn_transform_axes in category atom_sites.
The estimated standard deviation of attribute Cartn_y in category atom_site.
The z atom site coordinate in angstroms specified according to
a set of orthogonal Cartesian axes related to the cell axes as
specified by the description given in
attribute Cartn_transform_axes in category atom_sites.
The estimated standard deviation of attribute Cartn_z in category atom_site.
Equivalent isotropic atomic displacement parameter, U~equiv~,
in angstroms squared, calculated as the geometric mean of
the anisotropic atomic displacement parameters.
U~equiv~ = (U~i~ U~j~ U~k~)^1/3^
U~n~ = the principal components of the orthogonalised U~ij~
The estimated standard deviation of
attribute U_equiv_geom_mean in category atom_site.
Isotropic atomic displacement parameter, or equivalent isotropic
atomic displacement parameter, U~equiv~, calculated from
anisotropic atomic displacement parameters.
U~equiv~ = (1/3) sum~i~[sum~j~(U~ij~ A~i~ A~j~ a*~i~ a*~j~)]
A = the real space cell lengths
a* = the reciprocal space cell lengths
Ref: Fischer, R. X. & Tillmanns, E. (1988). Acta Cryst. C44,
775-776.
The estimated standard deviation of attribute U_iso_or_equiv in category atom_site.
The Wyckoff symbol (letter) as listed in the space-group section
of International Tables for Crystallography, Vol. A (1987).
The [1][1] element of the anisotropic atomic displacement
matrix B, which appears in the structure factor term as:
T = exp{-1/4 sum~i~[sum~j~(B~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The estimated standard deviation of attribute aniso_B[1][1] in category atom_site.
The [1][2] element of the anisotropic atomic displacement
matrix B, which appears in the structure factor term as:
T = exp{-1/4 sum~i~[sum~j~(B~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The estimated standard deviation of attribute aniso_B[1][2] in category atom_site.
The [1][3] element of the anisotropic atomic displacement
matrix B, which appears in the structure factor term as:
T = exp{-1/4 sum~i~[sum~j~(B~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The estimated standard deviation of attribute aniso_B[1][3] in category atom_site.
The [2][2] element of the anisotropic atomic displacement
matrix B, which appears in the structure factor term as:
T = exp{-1/4 sum~i~[sum~j~(B~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The estimated standard deviation of attribute aniso_B[2][2] in category atom_site.
The [2][3] element of the anisotropic atomic displacement
matrix B, which appears in the structure factor term as:
T = exp{-1/4 sum~i~[sum~j~(B~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The estimated standard deviation of attribute aniso_B[2][3] in category atom_site.
The [3][3] element of the anisotropic atomic displacement
matrix B, which appears in the structure factor term as:
T = exp{-1/4 sum~i~[sum~j~(B~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The estimated standard deviation of attribute aniso_B[3][3] in category atom_site.
The [1][1] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The estimated standard deviation of attribute aniso_U[1][1] in category atom_site.
The [1][2] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The estimated standard deviation of attribute aniso_U[1][2] in category atom_site.
The [1][3] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The estimated standard deviation of attribute aniso_U[1][3] in category atom_site.
The [2][2] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The estimated standard deviation of attribute aniso_U[2][2] in category atom_site.
The [2][3] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The estimated standard deviation of attribute aniso_U[2][3] in category atom_site.
The [3][3] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The estimated standard deviation of attribute aniso_U[3][3] in category atom_site.
Ratio of the maximum to minimum principal axes of
displacement (thermal) ellipsoids.
The number of hydrogen atoms attached to the atom at this site
excluding any H atoms for which coordinates (measured or
calculated) are given.
water oxygen
2
hydroxyl oxygen
1
ammonium nitrogen
4
An alternative identifier for attribute label_asym_id in category atom_site that
may be provided by an author in order to match the identification
used in the publication that describes the structure.
An alternative identifier for attribute label_atom_id in category atom_site that
may be provided by an author in order to match the identification
used in the publication that describes the structure.
An alternative identifier for attribute label_comp_id in category atom_site that
may be provided by an author in order to match the identification
used in the publication that describes the structure.
An alternative identifier for attribute label_seq_id in category atom_site that
may be provided by an author in order to match the identification
used in the publication that describes the structure.
Note that this is not necessarily a number, that the values do
not have to be positive, and that the value does not have to
correspond to the value of attribute label_seq_id in category atom_site. The value
of attribute label_seq_id in category atom_site is required to be a sequential list
of positive integers.
The author may assign values to attribute auth_seq_id in category atom_site in any
desired way. For instance, the values may be used to relate
this structure to a numbering scheme in a homologous structure,
including sequence gaps or insertion codes. Alternatively, a
scheme may be used for a truncated polymer that maintains the
numbering scheme of the full length polymer. In all cases, the
scheme used here must match the scheme used in the publication
that describes the structure.
The attribute id in category atom_site of the atom site to which the 'geometry-
calculated' atom site is attached.
A standard code to signal if the site data have been determined
from the intensities or calculated from the geometry of
surrounding sites, or have been assigned dummy coordinates. The
abbreviation 'c' may be used in place of 'calc'.
This data item is a pointer to attribute number in category chemical_conn_atom in the
CHEMICAL_CONN_ATOM category.
A description of the constraints applied to parameters at this
site during refinement. See also attribute refinement_flags
in category atom_site and attribute ls_number_constraints in category refine.
pop=1.0-pop(Zn3)
A description of special aspects of this site. See also
attribute refinement_flags in category atom_site.
Ag/Si disordered
A code which identifies a cluster of atoms that show long-range
positional disorder but are locally ordered. Within each such
cluster of atoms, attribute disorder_group in category atom_site is used to identify
the sites that are simultaneously occupied. This field is only
needed if there is more than one cluster of disordered atoms
showing independent local order.
*** This data item would not in general be used in a
macromolecular data block. ***
A code that identifies a group of positionally disordered atom
sites that are locally simultaneously occupied. Atoms that are
positionally disordered over two or more sites (e.g. the H
atoms of a methyl group that exists in two orientations) can
be assigned to two or more groups. Sites belonging to the same
group are simultaneously occupied, but those belonging to
different groups are not. A minus prefix (e.g. "-1") is used to
indicate sites disordered about a special position.
*** This data item would not in general be used in a
macromolecular data block. ***
The value of attribute footnote_id in category atom_site must match an id
specified by attribute id in category atom_sites_footnote in the
ATOM_SITES_FOOTNOTE list.
The x coordinate of the atom site position specified as a
fraction of attribute length_a in category cell.
The estimated standard deviation of attribute fract_x in category atom_site.
The y coordinate of the atom site position specified as a
fraction of attribute length_b in category cell.
The estimated standard deviation of attribute fract_y in category atom_site.
The z coordinate of the atom site position specified as a
fraction of attribute length_c in category cell.
The estimated standard deviation of attribute fract_z in category atom_site.
The group of atoms to which the atom site belongs. This data
item is provided for compatibility with the original Protein
Data Bank format, and only for that purpose.
A component of the macromolecular identifier for this atom site.
For further details, see the definition of the ATOM_SITE_ALT
category.
This data item is a pointer to attribute id in category atom_sites_alt in the
ATOM_SITES_ALT category.
A component of the macromolecular identifier for this atom site.
For further details, see the definition of the STRUCT_ASYM
category.
This data item is a pointer to attribute id in category struct_asym in the
STRUCT_ASYM category.
A component of the macromolecular identifier for this atom site.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
A component of the macromolecular identifier for this atom site.
This data item is a pointer to attribute id in category chem_comp in the CHEM_COMP
category.
This data item is a pointer to attribute id in category entity in the ENTITY category.
This data item is a pointer to attribute num in category entity_poly_seq in the
ENTITY_POLY_SEQ category.
The fraction of the atom type present at this site.
The sum of the occupancies of all the atom types at this site
may not significantly exceed 1.0 unless it is a dummy site.
The estimated standard deviation of attribute occupancy in category atom_site.
PDB atom name.
PDB insertion code.
PDB model number.
PDB residue name.
PDB residue number.
PDB strand id.
Author's alternate location identifier.
Author's atom name.
A concatenated series of single-letter codes which indicate the
refinement restraints or constraints applied to this site.
A description of restraints applied to specific parameters at
this site during refinement. See also attribute refinement_flags
in category atom_site and attribute ls_number_restraints in category refine.
restrained to planar ring
The multiplicity of a site due to the space-group symmetry as is
given in International Tables for Crystallography, Vol. A (1987).
A standard code used to describe the type of atomic displacement
parameters used for the site.
This data item is a pointer to attribute symbol in category atom_type in the
ATOM_TYPE category.
The value of attribute id in category atom_site must uniquely identify a record in the
ATOM_SITE list.
Note that this item need not be a number; it can be any unique
identifier.
This data item was introduced to facilitate compatibility between
small molecule and macromolecular files. In the small molecule
files, _atom_site_label is the identifier for the atom. In the
macromolecular files, the atom identifier is the aggregate of
_atom_site.label_alt_id, _atom_site.label_asym_id,
_atom_site.label_atom_id, _atom_site.label_comp_id and
attribute label_seq_id in category atom_site. For the two types of files to be
compatible, a formal identifier for the category had to be
introduced that was independent of the different modes of
identifying atoms. For compatibility with older files,
_atom_site_label is aliased to attribute id in category atom_site.
5
C12
Ca3g28
Fe3+17
H*251
boron2a
C_a_phe_83_a_0
Zn_Zn_301_A_0
Data items in the ATOM_SITE_ANISOTROP category record details
about temperature or thermal displacement factors, if those data
items are contained in a separate list from the ATOM_SITE list.
If the ATOM_SITE_ANISOTROP category is used for storing these
data, the corresponding ATOM_SITE data items are not used.
Example 1 - based on NDB structure BDL005 of Holbrook, Dickerson &
Kim [(1985). Acta Cryst. B41, 255-262].
<PDBx:atom_site_anisotropCategory>
<PDBx:atom_site_anisotrop id="1">
<PDBx:type_symbol>O</PDBx:type_symbol>
<PDBx:U11>8642</PDBx:U11>
<PDBx:U12>4866</PDBx:U12>
<PDBx:U13>7299</PDBx:U13>
<PDBx:U22>-342</PDBx:U22>
<PDBx:U23>-258</PDBx:U23>
<PDBx:U33>-1427</PDBx:U33>
</PDBx:atom_site_anisotrop>
<PDBx:atom_site_anisotrop id="2">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:U11>5174</PDBx:U11>
<PDBx:U12>4871</PDBx:U12>
<PDBx:U13>6243</PDBx:U13>
<PDBx:U22>-1885</PDBx:U22>
<PDBx:U23>-2051</PDBx:U23>
<PDBx:U33>-1377</PDBx:U33>
</PDBx:atom_site_anisotrop>
<PDBx:atom_site_anisotrop id="3">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:U11>6202</PDBx:U11>
<PDBx:U12>5020</PDBx:U12>
<PDBx:U13>4395</PDBx:U13>
<PDBx:U22>-1130</PDBx:U22>
<PDBx:U23>-556</PDBx:U23>
<PDBx:U33>-632</PDBx:U33>
</PDBx:atom_site_anisotrop>
<PDBx:atom_site_anisotrop id="4">
<PDBx:type_symbol>O</PDBx:type_symbol>
<PDBx:U11>4224</PDBx:U11>
<PDBx:U12>4700</PDBx:U12>
<PDBx:U13>5046</PDBx:U13>
<PDBx:U22>1105</PDBx:U22>
<PDBx:U23>-161</PDBx:U23>
<PDBx:U33>345</PDBx:U33>
</PDBx:atom_site_anisotrop>
<PDBx:atom_site_anisotrop id="5">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:U11>8684</PDBx:U11>
<PDBx:U12>4688</PDBx:U12>
<PDBx:U13>4171</PDBx:U13>
<PDBx:U22>-1850</PDBx:U22>
<PDBx:U23>-433</PDBx:U23>
<PDBx:U33>-292</PDBx:U33>
</PDBx:atom_site_anisotrop>
<PDBx:atom_site_anisotrop id="6">
<PDBx:type_symbol>O</PDBx:type_symbol>
<PDBx:U11>11226</PDBx:U11>
<PDBx:U12>5255</PDBx:U12>
<PDBx:U13>3532</PDBx:U13>
<PDBx:U22>-341</PDBx:U22>
<PDBx:U23>2685</PDBx:U23>
<PDBx:U33>1328</PDBx:U33>
</PDBx:atom_site_anisotrop>
<PDBx:atom_site_anisotrop id="7">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:U11>10214</PDBx:U11>
<PDBx:U12>2428</PDBx:U12>
<PDBx:U13>5614</PDBx:U13>
<PDBx:U22>-2610</PDBx:U22>
<PDBx:U23>-1940</PDBx:U23>
<PDBx:U33>902</PDBx:U33>
</PDBx:atom_site_anisotrop>
<PDBx:atom_site_anisotrop id="8">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:U11>4590</PDBx:U11>
<PDBx:U12>3488</PDBx:U12>
<PDBx:U13>5827</PDBx:U13>
<PDBx:U22>751</PDBx:U22>
<PDBx:U23>-770</PDBx:U23>
<PDBx:U33>986</PDBx:U33>
</PDBx:atom_site_anisotrop>
<PDBx:atom_site_anisotrop id="9">
<PDBx:type_symbol>N</PDBx:type_symbol>
<PDBx:U11>5014</PDBx:U11>
<PDBx:U12>4434</PDBx:U12>
<PDBx:U13>3447</PDBx:U13>
<PDBx:U22>-17</PDBx:U22>
<PDBx:U23>-1593</PDBx:U23>
<PDBx:U33>539</PDBx:U33>
</PDBx:atom_site_anisotrop>
</PDBx:atom_site_anisotropCategory>
The [1][1] element of the anisotropic atomic displacement
matrix B, which appears in the structure factor term as:
T = exp{-1/4 sum~i~[sum~j~(B~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The estimated standard deviation of attribute B[1][1] in category atom_site_anisotrop.
The [1][2] element of the anisotropic atomic displacement
matrix B, which appears in the structure factor term as:
T = exp{-1/4 sum~i~[sum~j~(B~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The estimated standard deviation of attribute B[1][2] in category atom_site_anisotrop.
The [1][3] element of the anisotropic atomic displacement
matrix B, which appears in the structure factor term as:
T = exp{-1/4 sum~i~[sum~j~(B~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The estimated standard deviation of attribute B[1][3] in category atom_site_anisotrop.
The [2][2] element of the anisotropic atomic displacement
matrix B, which appears in the structure factor term as:
T = exp{-1/4 sum~i~[sum~j~(B~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The estimated standard deviation of attribute B[2][2] in category atom_site_anisotrop.
The [2][3] element of the anisotropic atomic displacement
matrix B, which appears in the structure factor term as:
T = exp{-1/4 sum~i~[sum~j~(B~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The estimated standard deviation of attribute B[2][3] in category atom_site_anisotrop.
The [3][3] element of the anisotropic atomic displacement
matrix B, which appears in the structure factor term as:
T = exp{-1/4 sum~i~[sum~j~(B~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The IUCr Commission on Nomenclature recommends against the use
of B for reporting atomic displacement parameters. U, being
directly proportional to B, is preferred.
The estimated standard deviation of attribute B[3][3] in category atom_site_anisotrop.
The [1][1] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The estimated standard deviation of attribute U[1][1] in category atom_site_anisotrop.
The [1][2] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The estimated standard deviation of attribute U[1][2] in category atom_site_anisotrop.
The [1][3] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The estimated standard deviation of attribute U[1][3] in category atom_site_anisotrop.
The [2][2] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The estimated standard deviation of attribute U[2][2] in category atom_site_anisotrop.
The [2][3] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The estimated standard deviation of attribute U[2][3] in category atom_site_anisotrop.
The [3][3] element of the standard anisotropic atomic
displacement matrix U, which appears in the structure factor
term as:
T = exp{-2 pi^2^ sum~i~[sum~j~(U~ij~ h~i~ h~j~ a*~i~ a*~j~)]}
h = the Miller indices
a* = the reciprocal space cell lengths
These matrix elements may appear with atomic coordinates
in the ATOM_SITE category, or they may appear in the separate
ATOM_SITE_ANISOTROP category, but they may not appear in both
places. Similarly, anisotropic displacements may appear as
either B's or U's, but not as both.
The unique elements of the real symmetric matrix are
entered by row.
The estimated standard deviation of attribute U[3][3] in category atom_site_anisotrop.
Pointer to attribute pdbx_PDB_ins_code in category atom_site
Pointer to attribute pdbx_auth_alt_id in category atom_site.
Pointer to attribute auth_asym_id in category atom_site
Pointer to attribute auth_atom_id in category atom_site
Pointer to attribute auth_comp_id in category atom_site
Pointer to attribute auth_seq_id in category atom_site
Pointer to attribute label_alt_id in category atom_site.
Pointer to attribute label_asym_id in category atom_site
Pointer to attribute label_atom_id in category atom_site
Pointer to attribute label_comp_id in category atom_site
Pointer to attribute label_seq_id in category atom_site
Ratio of the maximum to minimum principal axes of
displacement (thermal) ellipsoids.
This data item is a pointer to attribute symbol in category atom_type in the
ATOM_TYPE category.
This data item is a pointer to attribute id in category atom_site in the ATOM_SITE
category.
Data items in the ATOM_SITES category record details about
the crystallographic cell and cell transformations, which are
common to all atom sites.
Example 1 - based on PDB entry 5HVP and/or laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:atom_sitesCategory>
<PDBx:atom_sites entry_id="5HVP">
<PDBx:Cartn_transform_axes>c along z, astar along x, b along y</PDBx:Cartn_transform_axes>
<PDBx:Cartn_transf_matrix11>58.39</PDBx:Cartn_transf_matrix11>
<PDBx:Cartn_transf_matrix12>0.00</PDBx:Cartn_transf_matrix12>
<PDBx:Cartn_transf_matrix13>0.00</PDBx:Cartn_transf_matrix13>
<PDBx:Cartn_transf_matrix21>0.00</PDBx:Cartn_transf_matrix21>
<PDBx:Cartn_transf_matrix22>86.70</PDBx:Cartn_transf_matrix22>
<PDBx:Cartn_transf_matrix23>0.00</PDBx:Cartn_transf_matrix23>
<PDBx:Cartn_transf_matrix31>0.00</PDBx:Cartn_transf_matrix31>
<PDBx:Cartn_transf_matrix32>0.00</PDBx:Cartn_transf_matrix32>
<PDBx:Cartn_transf_matrix33>46.27</PDBx:Cartn_transf_matrix33>
<PDBx:Cartn_transf_vector1>0.00</PDBx:Cartn_transf_vector1>
<PDBx:Cartn_transf_vector2>0.00</PDBx:Cartn_transf_vector2>
<PDBx:Cartn_transf_vector3>0.00</PDBx:Cartn_transf_vector3>
</PDBx:atom_sites>
</PDBx:atom_sitesCategory>
The [1][1] element of the 3x3 matrix used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute Cartn_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [1][2] element of the 3x3 matrix used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute Cartn_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [1][3] element of the 3x3 matrix used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute Cartn_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [2][1] element of the 3x3 matrix used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute Cartn_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [2][2] element of the 3x3 matrix used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute Cartn_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [2][3] element of the 3x3 matrix used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute Cartn_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [3][1] element of the 3x3 matrix used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute Cartn_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [3][2] element of the 3x3 matrix used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute Cartn_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [3][3] element of the 3x3 matrix used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute Cartn_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [1] element of the 3 element vector used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The rotation matrix is defined in
attribute Cartn_transf_matrix[][].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [2] element of the 3 element vector used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The rotation matrix is defined in
attribute Cartn_transf_matrix[][].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
The [3] element of the 3 element vector used to transform
fractional coordinates in the ATOM_SITE category to Cartesian
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The rotation matrix is defined in
attribute Cartn_transf_matrix[][].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~Cartesian~ = |21 22 23| |y|~fractional~ + |2|
|z'| |31 32 33| |z| |3|
A description of the relative alignment of the crystal cell
axes to the Cartesian orthogonal axes as applied in the
transformation matrix attribute Cartn_transf_matrix in category atom_sites.
a parallel to x; b in the plane of y & z
The [1][1] element of the 3x3 matrix used to transform Cartesian
coordinates in the ATOM_SITE category to fractional coordinates
in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute fract_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [1][2] element of the 3x3 matrix used to transform Cartesian
coordinates in the ATOM_SITE category to fractional coordinates
in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute fract_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [1][3] element of the 3x3 matrix used to transform Cartesian
coordinates in the ATOM_SITE category to fractional coordinates
in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute fract_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [2][1] element of the 3x3 matrix used to transform Cartesian
coordinates in the ATOM_SITE category to fractional coordinates
in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute fract_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [2][3] element of the 3x3 matrix used to transform Cartesian
coordinates in the ATOM_SITE category to fractional coordinates
in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute fract_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [2][3] element of the 3x3 matrix used to transform Cartesian
coordinates in the ATOM_SITE category to fractional coordinates
in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute fract_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [3][1] element of the 3x3 matrix used to transform Cartesian
coordinates in the ATOM_SITE category to fractional coordinates
in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute fract_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [3][2] element of the 3x3 matrix used to transform Cartesian
coordinates in the ATOM_SITE category to fractional coordinates
in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute fract_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [3][3] element of the 3x3 matrix used to transform Cartesian
coordinates in the ATOM_SITE category to fractional coordinates
in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x1 translation is defined in
attribute fract_transf_vector[].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [1] element of the 3 element vector used to transform
Cartesian coordinates in the ATOM_SITE category to fractional
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x3 rotation is defined in
attribute fract_transf_matrix[][].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [2] element of the 3 element vector used to transform
Cartesian coordinates in the ATOM_SITE category to fractional
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x3 rotation is defined in
attribute fract_transf_matrix[][].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
The [3] element of the 3 element vector used to transform
Cartesian coordinates in the ATOM_SITE category to fractional
coordinates in the same category. The axial alignments of this
transformation are described in attribute Cartn_transform_axes.
in category atom_sites The 3x3 rotation is defined in
attribute fract_transf_matrix[][].
in category atom_sites
|x'| |11 12 13| |x| |1|
|y'|~fractional~ = |21 22 23| |y|~Cartesian~ + |2|
|z'| |31 32 33| |z| |3|
A code which identifies the methods used to locate the initial
atomic sites. The solution_hydrogens code identifies how the
hydrogens were located.
*** This data item would not in general be used in a
macromolecular data block. ***
A code which identifies the methods used to locate the initial
atomic sites. The solution_primary code identifies how the first
atom sites were determined.
*** This data item would not in general be used in a
macromolecular data block. ***
A code which identifies the methods used to locate the initial
atomic sites. The solution_secondary code identifies
how the non-hydrogen sites not include in solution_primary
were located.
*** This data item would not in general be used in a
macromolecular data block. ***
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the ATOM_SITES_ALT category record details
about the structural ensembles that should be generated from
atom sites or groups of atom sites that are modeled in
alternative conformations in this data block.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:atom_sites_altCategory>
<PDBx:atom_sites_alt id="">
<PDBx:details> Atom sites with the alternative id set to null are not modeled in
alternative conformations</PDBx:details>
</PDBx:atom_sites_alt>
<PDBx:atom_sites_alt id="1">
<PDBx:details> Atom sites with the alternative id set to 1 have been modeled in
alternative conformations with respect to atom sites marked with
alternative id 2. The conformations of amino acid side chains
and solvent atoms with alternative id set to 1 correlate with the
conformation of the inhibitor marked with alternative id 1. They
have been given an occupancy of 0.58 to match the occupancy assigned
to the inhibitor.</PDBx:details>
</PDBx:atom_sites_alt>
<PDBx:atom_sites_alt id="2">
<PDBx:details> Atom sites with the alternative id set to 2 have been modeled in
alternative conformations with respect to atom sites marked with
alternative id 1. The conformations of amino acid side chains
and solvent atoms with alternative id set to 2 correlate with the
conformation of the inhibitor marked with alternative id 2. They
have been given an occupancy of 0.42 to match the occupancy assigned
to the inhibitor.</PDBx:details>
</PDBx:atom_sites_alt>
<PDBx:atom_sites_alt id="3">
<PDBx:details> Atom sites with the alternative id set to 3 have been modeled in
alternative conformations with respect to atoms marked with alternative
id 4. The conformations of amino acid side chains and solvent atoms with
alternative id set to 3 do not correlate with the conformation of the
inhibitor. These atom sites have arbitrarily been given an occupancy of
0.50.</PDBx:details>
</PDBx:atom_sites_alt>
<PDBx:atom_sites_alt id="4">
<PDBx:details> Atom sites with the alternative id set to 4 have been modeled in
alternative conformations with respect to atoms marked with alternative
id 3. The conformations of amino acid side chains and solvent atoms with
alternative id set to 4 do not correlate with the conformation of the
inhibitor. These atom sites have arbitrarily been given an occupancy of
0.50.</PDBx:details>
</PDBx:atom_sites_alt>
</PDBx:atom_sites_altCategory>
A description of special aspects of the modeling of atoms in
alternative conformations.
The value of attribute id in category atom_sites_alt must uniquely identify
a record in the ATOM_SITES_ALT list.
Note that this item need not be a number; it can be any unique
identifier.
orientation 1
molecule abc
Data items in the ATOM_SITES_ALT_ENS category record details
about the ensemble structure generated from atoms with various
alternative conformation ids.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:atom_sites_alt_ensCategory>
<PDBx:atom_sites_alt_ens id="Ensemble 1-A">
<PDBx:details> The inhibitor binds to the enzyme in two, roughly twofold symmetric,
alternative conformations.
This conformational ensemble includes the more populated conformation of
the inhibitor (id=1) and the amino acid side chains and solvent structure
that correlate with this inhibitor conformation.
Also included are one set (id=3) of side chains with alternative
conformations when the conformations are not correlated with the
inhibitor conformation.</PDBx:details>
</PDBx:atom_sites_alt_ens>
<PDBx:atom_sites_alt_ens id="Ensemble 1-B">
<PDBx:details> The inhibitor binds to the enzyme in two, roughly twofold symmetric
alternative conformations.
This conformational ensemble includes the more populated conformation of
the inhibitor (id=1) and the amino acid side chains and solvent structure
that correlate with this inhibitor conformation.
Also included are one set (id=4) of side chains with alternative
conformations when the conformations are not correlated with the
inhibitor conformation.</PDBx:details>
</PDBx:atom_sites_alt_ens>
<PDBx:atom_sites_alt_ens id="Ensemble 2-A">
<PDBx:details> The inhibitor binds to the enzyme in two, roughly twofold symmetric
alternative conformations.
This conformational ensemble includes the less populated conformation of
the inhibitor (id=2) and the amino acid side chains and solvent structure
that correlate with this inhibitor conformation.
Also included are one set (id=3) of side chains with alternative
conformations when the conformations are not correlated with the
inhibitor conformation.</PDBx:details>
</PDBx:atom_sites_alt_ens>
<PDBx:atom_sites_alt_ens id="Ensemble 2-B">
<PDBx:details> The inhibitor binds to the enzyme in two, roughly twofold symmetric
alternative conformations.
This conformational ensemble includes the less populated conformation of
the inhibitor (id=2) and the amino acid side chains and solvent structure
that correlate with this inhibitor conformation.
Also included are one set (id=4) of side chains with alternative
conformations when the conformations are not correlated with the
inhibitor conformation.</PDBx:details>
</PDBx:atom_sites_alt_ens>
</PDBx:atom_sites_alt_ensCategory>
A description of special aspects of the ensemble structure
generated from atoms with various alternative ids.
The value of attribute id in category atom_sites_alt_ens must uniquely identify a
record in the ATOM_SITES_ALT_ENS list.
Note that this item need not be a number; it can be any unique
identifier.
Data items in the ATOM_SITES_ALT_GEN category record details
about the interpretation of multiple conformations in the
structure.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:atom_sites_alt_genCategory>
<PDBx:atom_sites_alt_gen ens_id="Ensemble 1-A" alt_id=""></PDBx:atom_sites_alt_gen>
<PDBx:atom_sites_alt_gen ens_id="Ensemble 1-A" alt_id="1"></PDBx:atom_sites_alt_gen>
<PDBx:atom_sites_alt_gen ens_id="Ensemble 1-A" alt_id="3"></PDBx:atom_sites_alt_gen>
<PDBx:atom_sites_alt_gen ens_id="Ensemble 1-B" alt_id=""></PDBx:atom_sites_alt_gen>
<PDBx:atom_sites_alt_gen ens_id="Ensemble 1-B" alt_id="1"></PDBx:atom_sites_alt_gen>
<PDBx:atom_sites_alt_gen ens_id="Ensemble 1-B" alt_id="4"></PDBx:atom_sites_alt_gen>
<PDBx:atom_sites_alt_gen ens_id="Ensemble 2-A" alt_id=""></PDBx:atom_sites_alt_gen>
<PDBx:atom_sites_alt_gen ens_id="Ensemble 2-A" alt_id="2"></PDBx:atom_sites_alt_gen>
<PDBx:atom_sites_alt_gen ens_id="Ensemble 2-A" alt_id="3"></PDBx:atom_sites_alt_gen>
<PDBx:atom_sites_alt_gen ens_id="Ensemble 2-B" alt_id=""></PDBx:atom_sites_alt_gen>
<PDBx:atom_sites_alt_gen ens_id="Ensemble 2-B" alt_id="2"></PDBx:atom_sites_alt_gen>
<PDBx:atom_sites_alt_gen ens_id="Ensemble 2-B" alt_id="4"></PDBx:atom_sites_alt_gen>
</PDBx:atom_sites_alt_genCategory>
This data item is a pointer to attribute id in category atom_sites_alt_ens in the
ATOM_SITES_ALT_ENS category.
This data item is a pointer to attribute id in category atom_sites_alt in the
ATOM_SITES_ALT category.
Data items in the ATOM_SITES_FOOTNOTE category record detailed
comments about an atom site or group of atom sites.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:atom_sites_footnoteCategory>
<PDBx:atom_sites_footnote id="1">
<PDBx:text> The inhibitor binds to the enzyme in two alternative orientations. The
two orientations have been assigned alternative ids *1* and *2*.</PDBx:text>
</PDBx:atom_sites_footnote>
<PDBx:atom_sites_footnote id="2">
<PDBx:text> Side chains of these residues adopt alternative orientations that
correlate with the alternative orientations of the inhibitor.
Side chains with alternative id *1* and occupancy 0.58 correlate with
inhibitor orientation *1*.
Side chains with alternative id *2* and occupancy 0.42 correlate with
inhibitor orientation *2*.</PDBx:text>
</PDBx:atom_sites_footnote>
<PDBx:atom_sites_footnote id="3">
<PDBx:text> The positions of these water molecules correlate with the alternative
orientations of the inhibitor.
Water molecules with alternative id *1* and occupancy 0.58 correlate with
inhibitor orientation *1*.
Water molecules with alternative id *2* and occupancy 0.42 correlate with
inhibitor orientation *2*.</PDBx:text>
</PDBx:atom_sites_footnote>
<PDBx:atom_sites_footnote id="4">
<PDBx:text> Side chains of these residues adopt alternative orientations that do not
correlate with the alternative orientation of the inhibitor. </PDBx:text>
</PDBx:atom_sites_footnote>
<PDBx:atom_sites_footnote id="5">
<PDBx:text> The positions of these water molecules correlate with alternative
orientations of amino acid side chains that do not correlate with
alternative orientations of the inhibitor.</PDBx:text>
</PDBx:atom_sites_footnote>
</PDBx:atom_sites_footnoteCategory>
The text of the footnote. Footnotes are used to describe
an atom site or group of atom sites in the ATOM_SITE list.
For example, footnotes may be used to indicate atoms for which
the electron density is very weak, or atoms for which static
disorder has been modeled, among many other possibilities.
A code that identifies the footnote.
a
b
1
2
Data items in the ATOM_TYPE category record details about
properties of the atoms that occupy the atom sites, such as the
atomic scattering factors.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:atom_typeCategory>
<PDBx:atom_type symbol="C">
<PDBx:oxidation_number>0</PDBx:oxidation_number>
<PDBx:scat_Cromer_Mann_a1>2.31000</PDBx:scat_Cromer_Mann_a1>
<PDBx:scat_Cromer_Mann_a2>20.8439</PDBx:scat_Cromer_Mann_a2>
<PDBx:scat_Cromer_Mann_a3>1.02000</PDBx:scat_Cromer_Mann_a3>
<PDBx:scat_Cromer_Mann_a4>10.2075</PDBx:scat_Cromer_Mann_a4>
<PDBx:scat_Cromer_Mann_b1>1.58860</PDBx:scat_Cromer_Mann_b1>
<PDBx:scat_Cromer_Mann_b2>0.568700</PDBx:scat_Cromer_Mann_b2>
<PDBx:scat_Cromer_Mann_b3>0.865000</PDBx:scat_Cromer_Mann_b3>
<PDBx:scat_Cromer_Mann_b4>51.6512</PDBx:scat_Cromer_Mann_b4>
<PDBx:scat_Cromer_Mann_c>0.21560</PDBx:scat_Cromer_Mann_c>
</PDBx:atom_type>
<PDBx:atom_type symbol="N">
<PDBx:oxidation_number>0</PDBx:oxidation_number>
<PDBx:scat_Cromer_Mann_a1>12.2126</PDBx:scat_Cromer_Mann_a1>
<PDBx:scat_Cromer_Mann_a2>0.005700</PDBx:scat_Cromer_Mann_a2>
<PDBx:scat_Cromer_Mann_a3>3.13220</PDBx:scat_Cromer_Mann_a3>
<PDBx:scat_Cromer_Mann_a4>9.89330</PDBx:scat_Cromer_Mann_a4>
<PDBx:scat_Cromer_Mann_b1>2.01250</PDBx:scat_Cromer_Mann_b1>
<PDBx:scat_Cromer_Mann_b2>28.9975</PDBx:scat_Cromer_Mann_b2>
<PDBx:scat_Cromer_Mann_b3>1.16630</PDBx:scat_Cromer_Mann_b3>
<PDBx:scat_Cromer_Mann_b4>0.582600</PDBx:scat_Cromer_Mann_b4>
<PDBx:scat_Cromer_Mann_c>-11.529</PDBx:scat_Cromer_Mann_c>
</PDBx:atom_type>
<PDBx:atom_type symbol="O">
<PDBx:oxidation_number>0</PDBx:oxidation_number>
<PDBx:scat_Cromer_Mann_a1>3.04850</PDBx:scat_Cromer_Mann_a1>
<PDBx:scat_Cromer_Mann_a2>13.2771</PDBx:scat_Cromer_Mann_a2>
<PDBx:scat_Cromer_Mann_a3>2.28680</PDBx:scat_Cromer_Mann_a3>
<PDBx:scat_Cromer_Mann_a4>5.70110</PDBx:scat_Cromer_Mann_a4>
<PDBx:scat_Cromer_Mann_b1>1.54630</PDBx:scat_Cromer_Mann_b1>
<PDBx:scat_Cromer_Mann_b2>0.323900</PDBx:scat_Cromer_Mann_b2>
<PDBx:scat_Cromer_Mann_b3>0.867000</PDBx:scat_Cromer_Mann_b3>
<PDBx:scat_Cromer_Mann_b4>32.9089</PDBx:scat_Cromer_Mann_b4>
<PDBx:scat_Cromer_Mann_c>0.250800</PDBx:scat_Cromer_Mann_c>
</PDBx:atom_type>
<PDBx:atom_type symbol="S">
<PDBx:oxidation_number>0</PDBx:oxidation_number>
<PDBx:scat_Cromer_Mann_a1>6.90530</PDBx:scat_Cromer_Mann_a1>
<PDBx:scat_Cromer_Mann_a2>1.46790</PDBx:scat_Cromer_Mann_a2>
<PDBx:scat_Cromer_Mann_a3>5.20340</PDBx:scat_Cromer_Mann_a3>
<PDBx:scat_Cromer_Mann_a4>22.2151</PDBx:scat_Cromer_Mann_a4>
<PDBx:scat_Cromer_Mann_b1>1.43790</PDBx:scat_Cromer_Mann_b1>
<PDBx:scat_Cromer_Mann_b2>0.253600</PDBx:scat_Cromer_Mann_b2>
<PDBx:scat_Cromer_Mann_b3>1.58630</PDBx:scat_Cromer_Mann_b3>
<PDBx:scat_Cromer_Mann_b4>56.1720</PDBx:scat_Cromer_Mann_b4>
<PDBx:scat_Cromer_Mann_c>0.866900</PDBx:scat_Cromer_Mann_c>
</PDBx:atom_type>
<PDBx:atom_type symbol="CL">
<PDBx:oxidation_number>-1</PDBx:oxidation_number>
<PDBx:scat_Cromer_Mann_a1>18.2915</PDBx:scat_Cromer_Mann_a1>
<PDBx:scat_Cromer_Mann_a2>0.006600</PDBx:scat_Cromer_Mann_a2>
<PDBx:scat_Cromer_Mann_a3>7.20840</PDBx:scat_Cromer_Mann_a3>
<PDBx:scat_Cromer_Mann_a4>1.17170</PDBx:scat_Cromer_Mann_a4>
<PDBx:scat_Cromer_Mann_b1>6.53370</PDBx:scat_Cromer_Mann_b1>
<PDBx:scat_Cromer_Mann_b2>19.5424</PDBx:scat_Cromer_Mann_b2>
<PDBx:scat_Cromer_Mann_b3>2.33860</PDBx:scat_Cromer_Mann_b3>
<PDBx:scat_Cromer_Mann_b4>60.4486</PDBx:scat_Cromer_Mann_b4>
<PDBx:scat_Cromer_Mann_c>-16.378</PDBx:scat_Cromer_Mann_c>
</PDBx:atom_type>
</PDBx:atom_typeCategory>
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer [(1991).
Acta Cryst. C47, 2276-2277].
<PDBx:atom_typeCategory>
<PDBx:atom_type symbol="C">
<PDBx:oxidation_number>0</PDBx:oxidation_number>
<PDBx:number_in_cell>72</PDBx:number_in_cell>
<PDBx:scat_dispersion_real>.017</PDBx:scat_dispersion_real>
<PDBx:scat_dispersion_imag>.009</PDBx:scat_dispersion_imag>
<PDBx:scat_source>International_Tables_Vol_IV_Table_2.2B</PDBx:scat_source>
</PDBx:atom_type>
<PDBx:atom_type symbol="H">
<PDBx:oxidation_number>0</PDBx:oxidation_number>
<PDBx:number_in_cell>100</PDBx:number_in_cell>
<PDBx:scat_dispersion_real>0</PDBx:scat_dispersion_real>
<PDBx:scat_dispersion_imag>0</PDBx:scat_dispersion_imag>
<PDBx:scat_source>International_Tables_Vol_IV_Table_2.2B</PDBx:scat_source>
</PDBx:atom_type>
<PDBx:atom_type symbol="O">
<PDBx:oxidation_number>0</PDBx:oxidation_number>
<PDBx:number_in_cell>12</PDBx:number_in_cell>
<PDBx:scat_dispersion_real>.047</PDBx:scat_dispersion_real>
<PDBx:scat_dispersion_imag>.032</PDBx:scat_dispersion_imag>
<PDBx:scat_source>International_Tables_Vol_IV_Table_2.2B</PDBx:scat_source>
</PDBx:atom_type>
<PDBx:atom_type symbol="N">
<PDBx:oxidation_number>0</PDBx:oxidation_number>
<PDBx:number_in_cell>4</PDBx:number_in_cell>
<PDBx:scat_dispersion_real>.029</PDBx:scat_dispersion_real>
<PDBx:scat_dispersion_imag>.018</PDBx:scat_dispersion_imag>
<PDBx:scat_source>International_Tables_Vol_IV_Table_2.2B</PDBx:scat_source>
</PDBx:atom_type>
</PDBx:atom_typeCategory>
Mass percentage of this atom type derived from chemical analysis.
A description of the atom(s) designated by this atom type. In
most cases this is the element name and oxidation state of
a single atom species. For disordered or nonstoichiometric
structures it will describe a combination of atom species.
deuterium
0.34Fe+0.66Ni
Total number of atoms of this atom type in the unit cell.
Formal oxidation state of this atom type in the structure.
The effective intramolecular bonding radius in angstroms
of this atom type.
The effective intermolecular bonding radius in angstroms
of this atom type.
The a1 Cromer-Mann scattering-factor coefficient used to
calculate the scattering factors for this atom type.
Ref: International Tables for X-ray Crystallography, Vol. IV,
(1974). Table 2.2B.
or: International Tables for Crystallography, Vol. C,
(1991). Tables 6.1.1.4 and 6.1.1.5.
The a2 Cromer-Mann scattering-factor coefficient used to
calculate the scattering factors for this atom type.
Ref: International Tables for X-ray Crystallography, Vol. IV,
(1974). Table 2.2B.
or: International Tables for Crystallography, Vol. C,
(1991). Tables 6.1.1.4 and 6.1.1.5.
The a3 Cromer-Mann scattering-factor coefficient used to
calculate the scattering factors for this atom type.
Ref: International Tables for X-ray Crystallography, Vol. IV,
(1974). Table 2.2B.
or: International Tables for Crystallography, Vol. C,
(1991). Tables 6.1.1.4 and 6.1.1.5.
The a4 Cromer-Mann scattering-factor coefficient used to
calculate the scattering factors for this atom type.
Ref: International Tables for X-ray Crystallography, Vol. IV,
(1974). Table 2.2B.
or: International Tables for Crystallography, Vol. C,
(1991). Tables 6.1.1.4 and 6.1.1.5.
The b1 Cromer-Mann scattering-factor coefficient used to
calculate the scattering factors for this atom type.
Ref: International Tables for X-ray Crystallography, Vol. IV,
(1974). Table 2.2B.
or: International Tables for Crystallography, Vol. C,
(1991). Tables 6.1.1.4 and 6.1.1.5.
The b2 Cromer-Mann scattering-factor coefficient used to
calculate the scattering factors for this atom type.
Ref: International Tables for X-ray Crystallography, Vol. IV,
(1974). Table 2.2B.
or: International Tables for Crystallography, Vol. C,
(1991). Tables 6.1.1.4 and 6.1.1.5.
The b3 Cromer-Mann scattering-factor coefficient used to
calculate the scattering factors for this atom type.
Ref: International Tables for X-ray Crystallography, Vol. IV,
(1974). Table 2.2B.
or: International Tables for Crystallography, Vol. C,
(1991). Tables 6.1.1.4 and 6.1.1.5.
The b4 Cromer-Mann scattering-factor coefficient used to
calculate the scattering factors for this atom type.
Ref: International Tables for X-ray Crystallography, Vol. IV,
(1974). Table 2.2B.
or: International Tables for Crystallography, Vol. C,
(1991). Tables 6.1.1.4 and 6.1.1.5.
The c Cromer-Mann scattering-factor coefficient used to
calculate the scattering factors for this atom type.
Ref: International Tables for X-ray Crystallography, Vol. IV,
(1974). Table 2.2B.
or: International Tables for Crystallography, Vol. C,
(1991). Tables 6.1.1.4 and 6.1.1.5.
The imaginary component of the anomalous dispersion
scattering factors, f'' (in electrons), for this atom type and
the radiation identified by attribute id in category diffrn_radiation_wavelength.
The real component of the anomalous dispersion
scattering factors, f' (in electrons), for this atom type and
the radiation identified by attribute id in category diffrn_radiation_wavelength.
The bound coherent scattering length in femtometres for the
atom type at the isotopic composition used for the diffraction
experiment.
Reference to source of scattering factors used for this atom
type.
International Tables Vol IV Table 2.4.6B
A table of scattering factors as a function of sin theta over
lambda. This table should be well commented to indicate the
items present. Regularly formatted lists are strongly
recommended.
The code used to identify the atom specie(s) representing this
atom type. Normally this code is the element symbol. The code
may be composed of any character except an underline with the
additional proviso that digits designate an oxidation state and
must be followed by a + or - character.
C
Cu2+
H(SDS)
dummy
FeNi
Data items in the AUDIT category record details about the
creation and subsequent updating of the data block.
Note that these items apply only to the creation and updating of
the data block, and should not be confused with the data items
(in the JOURNAL category) that describe the time course of
publication of the material in the data block.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:auditCategory>
<PDBx:audit revision_id="1">
<PDBx:creation_date>1992-12-08</PDBx:creation_date>
<PDBx:creation_method> Created by hand from PDB entry 5HVP, from the J. Biol. Chem. paper
describing this structure and from laboratory records</PDBx:creation_method>
<PDBx:update_record> 1992-12-09 adjusted to reflect comments from Brian McKeever
1992-12-10 adjusted to reflect comments from Helen Berman
1992-12-12 adjusted to reflect comments from Keith Watenpaugh</PDBx:update_record>
</PDBx:audit>
</PDBx:auditCategory>
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer [(1991).
Acta Cryst. C47, 2276-2277].
<PDBx:auditCategory>
<PDBx:audit>
<PDBx:creation_date>1991-03-20</PDBx:creation_date>
<PDBx:creation_method>from_xtal_archive_file_using_CIFIO</PDBx:creation_method>
<PDBx:update_record> 1991-04-09 text and data added by Tony Willis.
1991-04-15 rec'd by co-editor with diagram as manuscript HL7.
1991-04-17 adjustments based on first referees report.
1991-04-18 adjustments based on second referees report.</PDBx:update_record>
</PDBx:audit>
</PDBx:auditCategory>
A date that the data block was created. The date format is
yyyy-mm-dd.
1990-07-12
A description of how data were entered into the data block.
spawned by the program QBEE
A record of any changes to the data block. The update format is
a date (yyyy-mm-dd) followed by a description of the changes.
The latest update entry is added to the bottom of this record.
1990-07-15 Updated by the Co-editor
The value of attribute revision_id in category audit must uniquely identify a record
in the AUDIT list.
rev1
Data items in the AUDIT_AUTHOR category record details about
the author(s) of the data block.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:audit_authorCategory>
<PDBx:audit_author name="Fitzgerald, Paula M.D.">
<PDBx:address> Department of Biophysical Chemistry
Merck Research Laboratories
P. O. Box 2000, Ry80M203
Rahway, New Jersey 07065
USA</PDBx:address>
</PDBx:audit_author>
<PDBx:audit_author name="McKeever, Brian M.">
<PDBx:address> Department of Biophysical Chemistry
Merck Research Laboratories
P. O. Box 2000, Ry80M203
Rahway, New Jersey 07065
USA</PDBx:address>
</PDBx:audit_author>
<PDBx:audit_author name="Van Middlesworth, J.F.">
<PDBx:address> Department of Biophysical Chemistry
Merck Research Laboratories
P. O. Box 2000, Ry80M203
Rahway, New Jersey 07065
USA</PDBx:address>
</PDBx:audit_author>
<PDBx:audit_author name="Springer, James P.">
<PDBx:address> Department of Biophysical Chemistry
Merck Research Laboratories
P. O. Box 2000, Ry80M203
Rahway, New Jersey 07065
USA</PDBx:address>
</PDBx:audit_author>
</PDBx:audit_authorCategory>
The address of an author of this data block. If there are
multiple authors, attribute address in category audit_author is looped with
attribute name in category audit_author.
Department
Institute
Street
City and postcode
COUNTRY
The name of an author of this data block. If there are multiple
authors, _audit_author.name is looped with _audit_author.address.
The family name(s), followed by a comma and including any
dynastic compoents, precedes the first name(s) or initial(s).
Bleary, Percival R.
O'Neil, F.K.
Van den Bossche, G.
Yang, D.-L.
Simonov, Yu.A
Data items in the AUDIT_CONFORM category describe the
dictionary versions against which the data names appearing in
the current data block are conformant.
Example 1 - Any file conforming to the current CIF core dictionary.
<PDBx:audit_conformCategory>
<PDBx:audit_conform dict_name="cif_core.dic" dict_version="2.0">
<PDBx:dict_location>ftp://ftp.iucr.ac.uk/pub/cifdic.c96</PDBx:dict_location>
</PDBx:audit_conform>
</PDBx:audit_conformCategory>
A file name or uniform resource locator (URL) where the
conformant dictionary resides.
The string identifying the highest-level dictionary defining
datanames used in this file.
The version number of the conformant dictionary.
Data items in the AUDIT_CONTACT_AUTHOR category record details
about the name and address of the author to be contacted
concerning the contents of this data block.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:audit_contact_authorCategory>
<PDBx:audit_contact_author name="Fitzgerald, Paula M.D.">
<PDBx:address> Department of Biophysical Chemistry
Merck Research Laboratories
P. O. Box 2000, Ry80M203
Rahway, New Jersey 07065
USA</PDBx:address>
<PDBx:phone>908 594 5510</PDBx:phone>
<PDBx:fax>908 594 6645</PDBx:fax>
<PDBx:email>paula_fitzgerald@merck.com</PDBx:email>
</PDBx:audit_contact_author>
</PDBx:audit_contact_authorCategory>
The mailing address of the author of the data block to whom
correspondence should be addressed.
Department
Institute
Street
City and postcode
COUNTRY
The electronic mail address of the author of the data block to
whom correspondence should be addressed, in a form recognisable
to international networks.
name@host.domain.country
bm@iucr.ac.uk
The facsimile telephone number of the author of the data
block to whom correspondence should be addressed.
The recommended style includes the international dialing
prefix, the area code in parentheses, followed by the
local number with no spaces. The earlier convention of including
the international dialing prefixes in parentheses is no longer
recommended.
12(34)9477334
12()349477334
The telephone number of the author of the data block to whom
correspondence should be addressed.
The recommended style includes the international dialing
prefix, the area code in parentheses, followed by the
local number and any extension number prefixed by 'x',
with no spaces. The earlier convention of including
the international dialing prefixes in parentheses is no longer
recommended.
12(34)9477330
12()349477330
12(34)9477330x5543
The name of the author of the data block to whom correspondence
should be addressed.
The family name(s), followed by a comma and including any
dynastic components, precedes the first name(s) or initial(s).
Bleary, Percival R.
O'Neil, F.K.
Van den Bossche, G.
Yang, D.-L.
Simonov, Yu.A
Data items in the CELL category record details about the
crystallographic cell parameters.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:cellCategory>
<PDBx:cell entry_id="5HVP">
<PDBx:length_a>58.39</PDBx:length_a>
<PDBx:length_a_esd>0.05</PDBx:length_a_esd>
<PDBx:length_b>86.70</PDBx:length_b>
<PDBx:length_b_esd>0.12</PDBx:length_b_esd>
<PDBx:length_c>46.27</PDBx:length_c>
<PDBx:length_c_esd>0.06</PDBx:length_c_esd>
<PDBx:angle_alpha>90.00</PDBx:angle_alpha>
<PDBx:angle_beta>90.00</PDBx:angle_beta>
<PDBx:angle_gamma>90.00</PDBx:angle_gamma>
<PDBx:volume>234237</PDBx:volume>
<PDBx:details> The cell parameters were refined every twenty frames during data
integration. The cell lengths given are the mean of 55 such refinements;
the esds given are the root mean square deviations of these 55
observations from that mean.</PDBx:details>
</PDBx:cell>
</PDBx:cellCategory>
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer [(1991).
Acta Cryst. C47, 2276-2277].
<PDBx:cellCategory>
<PDBx:cell>
<PDBx:length_a>5.959</PDBx:length_a>
<PDBx:length_a_esd>0.001</PDBx:length_a_esd>
<PDBx:length_b>14.956</PDBx:length_b>
<PDBx:length_b_esd>0.001</PDBx:length_b_esd>
<PDBx:length_c>19.737</PDBx:length_c>
<PDBx:length_c_esd>0.003</PDBx:length_c_esd>
<PDBx:angle_alpha>90.0</PDBx:angle_alpha>
<PDBx:angle_beta>90.0</PDBx:angle_beta>
<PDBx:angle_gamma>90.0</PDBx:angle_gamma>
<PDBx:volume>1759.0</PDBx:volume>
<PDBx:volume_esd>0.3</PDBx:volume_esd>
</PDBx:cell>
</PDBx:cellCategory>
The number of the polymeric chains in a unit cell. In the case
of heteropolymers, Z is the number of occurrences of the most
populous chain.
This data item is provided for compatibility with the original
Protein Data Bank format, and only for that purpose.
Unit-cell angle alpha in degrees of the reported structure.
The estimated standard deviation of attribute angle_alpha in category cell.
Unit-cell angle beta in degrees of the reported structure.
The estimated standard deviation of attribute angle_beta in category cell.
Unit-cell angle gamma in degrees of the reported structure.
The estimated standard deviation of attribute angle_gamma in category cell.
A description of special aspects of the cell choice, noting
possible alternative settings.
pseudo-orthorhombic
standard setting from 45 deg rotation
around c
The number of the formula units in the unit cell as specified
by _chemical_formula.structural, _chemical_formula.moiety or
attribute sum in category chemical_formula.
Unit-cell length a corresponding to the structure reported.
The estimated standard deviation of attribute length_a in category cell.
Unit-cell length b corresponding to the structure reported.
The estimated standard deviation of attribute length_b in category cell.
Unit-cell length c corresponding to the structure reported.
The estimated standard deviation of attribute length_c in category cell.
To further identify unique axis if necessary. E.g., P 21 with
an unique C axis will have 'C' in this field.
Cell volume V in angstroms cubed.
V = a b c (1 - cos^2^~alpha~ - cos^2^~beta~ - cos^2^~gamma~
+ 2 cos~alpha~ cos~beta~ cos~gamma~)^1/2^
a = attribute length_a
in category cell b = attribute length_b
in category cell c = attribute length_c
in category cell alpha = attribute angle_alpha
in category cell beta = attribute angle_beta
in category cell gamma = attribute angle_gamma in category cell
The estimated standard deviation of attribute volume in category cell.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the CELL_MEASUREMENT category record details
about the measurement of the crystallographic cell parameters.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:cell_measurementCategory>
<PDBx:cell_measurement entry_id="5HVP">
<PDBx:temp>293</PDBx:temp>
<PDBx:temp_esd>3</PDBx:temp_esd>
<PDBx:theta_min>11</PDBx:theta_min>
<PDBx:theta_max>31</PDBx:theta_max>
<PDBx:wavelength>1.54</PDBx:wavelength>
</PDBx:cell_measurement>
</PDBx:cell_measurementCategory>
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer [(1991).
Acta Cryst. C47, 2276-2277].
<PDBx:cell_measurementCategory>
<PDBx:cell_measurement>
<PDBx:temp>293</PDBx:temp>
<PDBx:reflns_used>25</PDBx:reflns_used>
<PDBx:theta_min>25</PDBx:theta_min>
<PDBx:theta_max>31</PDBx:theta_max>
</PDBx:cell_measurement>
</PDBx:cell_measurementCategory>
The pressure in kilopascals at which the unit-cell parameters
were measured (not the pressure used to synthesize the sample).
The estimated standard deviation of attribute pressure in category cell_measurement.
Description of the radiation used to measure the unit-cell data.
See also attribute wavelength in category cell_measurement.
neutron
Cu K\a
synchrotron
The total number of reflections used to determine the unit cell.
These reflections may be specified as CELL_MEASUREMENT_REFLN
data items.
The temperature in kelvins at which the unit-cell parameters
were measured (not the temperature of synthesis).
The estimated standard deviation of attribute temp in category cell_measurement.
The maximum theta angle in degrees of reflections used to measure
the unit cell.
The minimum theta angle in degrees of reflections used to measure
the unit cell.
The wavelength in angstroms of the radiation used to measure
the unit cell. If this is not specified, the wavelength is
assumed to be that specified in the category
DIFFRN_RADIATION_WAVELENGTH.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the CELL_MEASUREMENT_REFLN category record
details about the reflections used in determination of the
crystallographic cell parameters.
The CELL_MEASUREMENT_REFLN data items would in general be used
only for diffractometer data.
Example 1 - extracted from the CAD-4 listing of Rb~2~S~2~O~6~ at room
temperature (not yet published).
<PDBx:cell_measurement_reflnCategory>
<PDBx:cell_measurement_refln index_h="-2" index_k="4" index_l="1">
<PDBx:theta>8.67</PDBx:theta>
</PDBx:cell_measurement_refln>
<PDBx:cell_measurement_refln index_h="0" index_k="3" index_l="2">
<PDBx:theta>9.45</PDBx:theta>
</PDBx:cell_measurement_refln>
<PDBx:cell_measurement_refln index_h="3" index_k="0" index_l="2">
<PDBx:theta>9.46</PDBx:theta>
</PDBx:cell_measurement_refln>
<PDBx:cell_measurement_refln index_h="-3" index_k="4" index_l="1">
<PDBx:theta>8.93</PDBx:theta>
</PDBx:cell_measurement_refln>
<PDBx:cell_measurement_refln index_h="-2" index_k="1" index_l="-2">
<PDBx:theta>7.53</PDBx:theta>
</PDBx:cell_measurement_refln>
<PDBx:cell_measurement_refln index_h="10" index_k="0" index_l="0">
<PDBx:theta>23.77</PDBx:theta>
</PDBx:cell_measurement_refln>
<PDBx:cell_measurement_refln index_h="0" index_k="10" index_l="0">
<PDBx:theta>23.78</PDBx:theta>
</PDBx:cell_measurement_refln>
<PDBx:cell_measurement_refln index_h="-5" index_k="4" index_l="1">
<PDBx:theta>11.14</PDBx:theta>
</PDBx:cell_measurement_refln>
</PDBx:cell_measurement_reflnCategory>
Theta angle in degrees of a reflection used for measurement of
the unit cell.
Miller index h of a reflection used for measurement of the unit
cell.
Miller index k of a reflection used for measurement of the unit
cell.
Miller index l of a reflection used for measurement of the unit
cell.
Data items in the CHEM_COMP category give details (such as
name, mass, charge, etc.) about each of the chemical components
from which the relevant chemical structures can be constructed.
The related categories CHEM_COMP_ATOM, CHEM_COMP_BOND,
CHEM_COMP_ANGLE, etc. describe the detailed geometry of these
chemical components.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:chem_compCategory>
<PDBx:chem_comp id="phe">
<PDBx:model_source>1987 Protin/Prolsq Ideals file</PDBx:model_source>
<PDBx:name>phenylalanine</PDBx:name>
</PDBx:chem_comp>
<PDBx:chem_comp id="val">
<PDBx:model_source>1987 Protin/Prolsq Ideals file</PDBx:model_source>
<PDBx:name>alanine</PDBx:name>
</PDBx:chem_comp>
</PDBx:chem_compCategory>
The formula for the chemical component. Formulae are written
according to the rules:
1. Only recognised element symbols may be used.
2. Each element symbol is followed by a 'count' number. A count
of '1' may be omitted.
3. A space or parenthesis must separate each element symbol and
its count, but in general parentheses are not used.
4. The order of elements depends on whether or not carbon is
present. If carbon is present, the order should be: C, then
H, then the other elements in alphabetical order of their
symbol. If carbon is not present, the elements are listed
purely in alphabetic order of their symbol. This is the
'Hill' system used by Chemical Abstracts.
C18 H19 N7 O8 S
Formula mass in daltons of the chemical component.
A description of special aspects of the generation of the
coordinates for the model of the component.
geometry idealized but not minimized
A pointer to an 'external reference file', if the atomic
description of the component is taken from such a file.
The source of the coordinates for the model of the component.
CSD entry ABCDEF
built using Quanta/Charmm
A description of the class of a non-standard monomer, if the
group represents a modification of a standard monomer.
iodinated base
phosphorylated amino acid
brominated base
modified amino acid
glycosylated amino acid
A description of special details of a non-standard monomer.
'yes' indicates that this is a "standard" monomer, 'no' that it
is "non-standard." Non-standard monomers should be further
described using the attribute mon_nstd_parent,
in category chem_comp _chem_comp.mon_nstd_class, and _chem_comp.mon_nstd_details data
items.
A name of the parent monomer of the non-standard monomer,
if this group represents a modification of a standard monomer.
tyrosine
cytosine
The identifier for the parent component of the non-standard
component.
This data item is a pointer to attribute id in category chem_comp in the CHEM_COMP
category.
The full name of the component.
alanine
valine
adenine
cytosine
The total number of atoms in the component.
The number of non-hydrogen atoms in the component.
For standard polymer components, the one-letter code for
the component. If there is not a standard one-letter code
for this component, or if this is a non-polymer
component, the one-letter code should be given as 'X'.
This code may be preceded by a '+' character to indicate
that the component is a modification of a standard
component.
alanine or adenine
A
ambiguous asparagine/aspartic-acid
B
arginine
R
asparagine
N
aspartic-acid
D
cysteine or cystine or cytosine
C
glutamine
Q
glutamic-acid
E
ambiguous glutamine/glutamic acid
Z
glycine or guanine
G
histidine
H
isoleucine
I
leucine
L
lysine
K
methionine
M
phenylalanine
F
proline
P
serine
S
threonine or thymine
T
tryptophan
W
tyrosine
Y
valine
V
uracil
U
water
O
other
X
Atom name alignment offset in PDB atom field.
A serial number used by PDB in the FORMUL record.
3
The net integer charge assigned to this component. This is the
formal charge assignment normally found in chemical diagrams.
For nonstandard components a text description
of modification of the parent component.
ATP
Synonym list for the component.
ATP
A preliminary classification used by PDB.
For standard polymer components, the three-letter code for
the component. If there is not a standard three-letter code
for this component, or if this is a non-polymer
component, the three-letter code should be given as 'UNK'.
This code may be preceded by a '+' character to indicate
that the component is a modification of a standard
component.
alanine
ALA
arginine
ARG
asparagine
ASN
aspartic-acid
ASP
ambiguous asparagine/aspartic-acid
ASX
cysteine
CYS
glutamine
GLN
glutamic-acid
GLU
glycine
GLY
ambiguous glutamine/glutamic acid
GLX
histidine
HIS
isoleucine
ILE
leucine
LEU
lysine
LYS
methionine
MET
phenylalanine
PHE
proline
PRO
serine
SER
threonine
THR
tryptophan
TRP
tyrosine
TRY
valine
VAL
1-methyladenosine
1MA
5-methycytosine
5MC
2(prime)-O-methycytodine
OMC
1-methyguanosine
1MG
N(2)-methyguanosine
2MG
N(2)-dimethyguanosine
M2G
7-methyguanosine
7MG
2(prime)-O-methyguanosine
0MG
diydrouridine
H2U
ribosylthymidine
5MU
pseudouridine
PSU
acetic acid
ACE
formic acid
FOR
water
HOH
other
UNK
For standard polymer components, the type of the monomer.
Note that monomers that will form polymers are of three types:
linking monomers, monomers with some type of N-terminal (or 5')
cap, and monomers with some type of C-terminal (or 3') cap.
The value of attribute id in category chem_comp must uniquely identify each item in
the CHEM_COMP list.
For protein polymer entities, this is the three-letter code for
amino acids.
For nucleic acid polymer entities, this is the one-letter code
for the bases.
ala
val
A
C
Data items in the CHEM_COMP_ANGLE category record details about
angles in a chemical component. Angles are designated by three
atoms, with the second atom forming the vertex of the angle.
Target values may be specified as angles in degrees, as a
distance between the first and third atoms, or both.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:chem_comp_angleCategory>
<PDBx:chem_comp_angle comp_id="phe" atom_id_1="N" atom_id_2="CA" atom_id_3="C">
<PDBx:value_angle>xxx.xx</PDBx:value_angle>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_angle>
<PDBx:chem_comp_angle comp_id="phe" atom_id_1="CA" atom_id_2="C" atom_id_3="O">
<PDBx:value_angle>xxx.xx</PDBx:value_angle>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_angle>
<PDBx:chem_comp_angle comp_id="phe" atom_id_1="CB" atom_id_2="CA" atom_id_3="C">
<PDBx:value_angle>xxx.xx</PDBx:value_angle>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_angle>
<PDBx:chem_comp_angle comp_id="phe" atom_id_1="CB" atom_id_2="CA" atom_id_3="N">
<PDBx:value_angle>xxx.xx</PDBx:value_angle>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_angle>
<PDBx:chem_comp_angle comp_id="phe" atom_id_1="CA" atom_id_2="CB" atom_id_3="CG">
<PDBx:value_angle>xxx.xx</PDBx:value_angle>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_angle>
<PDBx:chem_comp_angle comp_id="phe" atom_id_1="CB" atom_id_2="CG" atom_id_3="CD1">
<PDBx:value_angle>xxx.xx</PDBx:value_angle>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_angle>
<PDBx:chem_comp_angle comp_id="phe" atom_id_1="CB" atom_id_2="CG" atom_id_3="CD2">
<PDBx:value_angle>xxx.xx</PDBx:value_angle>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_angle>
<PDBx:chem_comp_angle comp_id="phe" atom_id_1="CD1" atom_id_2="CG" atom_id_3="CD2">
<PDBx:value_angle>xxx.xx</PDBx:value_angle>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_angle>
<PDBx:chem_comp_angle comp_id="phe" atom_id_1="CG" atom_id_2="CD1" atom_id_3="CE1">
<PDBx:value_angle>xxx.xx</PDBx:value_angle>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_angle>
<PDBx:chem_comp_angle comp_id="phe" atom_id_1="CD1" atom_id_2="CE1" atom_id_3="CZ">
<PDBx:value_angle>xxx.xx</PDBx:value_angle>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_angle>
<PDBx:chem_comp_angle comp_id="phe" atom_id_1="CE1" atom_id_2="CZ" atom_id_3="CE2">
<PDBx:value_angle>xxx.xx</PDBx:value_angle>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_angle>
<PDBx:chem_comp_angle comp_id="phe" atom_id_1="CZ" atom_id_2="CE2" atom_id_3="CD2">
<PDBx:value_angle>xxx.xx</PDBx:value_angle>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_angle>
<PDBx:chem_comp_angle comp_id="phe" atom_id_1="CG" atom_id_2="CD2" atom_id_3="CE2">
<PDBx:value_angle>xxx.xx</PDBx:value_angle>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_angle>
<PDBx:chem_comp_angle comp_id="val" atom_id_1="N" atom_id_2="CA" atom_id_3="C">
<PDBx:value_angle>xxx.xx</PDBx:value_angle>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_angle>
<PDBx:chem_comp_angle comp_id="val" atom_id_1="CA" atom_id_2="C" atom_id_3="O">
<PDBx:value_angle>xxx.xx</PDBx:value_angle>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_angle>
<PDBx:chem_comp_angle comp_id="val" atom_id_1="CB" atom_id_2="CA" atom_id_3="C">
<PDBx:value_angle>xxx.xx</PDBx:value_angle>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_angle>
<PDBx:chem_comp_angle comp_id="val" atom_id_1="CB" atom_id_2="CA" atom_id_3="N">
<PDBx:value_angle>xxx.xx</PDBx:value_angle>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_angle>
<PDBx:chem_comp_angle comp_id="val" atom_id_1="CA" atom_id_2="CB" atom_id_3="CG1">
<PDBx:value_angle>xxx.xx</PDBx:value_angle>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_angle>
<PDBx:chem_comp_angle comp_id="val" atom_id_1="CA" atom_id_2="CB" atom_id_3="CG2">
<PDBx:value_angle>xxx.xx</PDBx:value_angle>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_angle>
<PDBx:chem_comp_angle comp_id="val" atom_id_1="CG1" atom_id_2="CB" atom_id_3="CG2">
<PDBx:value_angle>xxx.xx</PDBx:value_angle>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_angle>
</PDBx:chem_comp_angleCategory>
The value that should be taken as the target value for the angle
associated with the specified atoms, expressed in degrees.
The estimated standard deviation of
attribute value_angle in category chem_comp_angle.
The value that should be taken as the target value for the angle
associated with the specified atoms, expressed as the distance
between the atoms specified by attribute atom_id_1 in category chem_comp_angle and
attribute atom_id_3 in category chem_comp_angle.
The estimated standard deviation of
attribute value_dist_esd in category chem_comp_angle.
This data item is a pointer to attribute id in category chem_comp in the CHEM_COMP
category.
The id of the first of the three atoms that define the angle.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
The id of the second of the three atoms that define the angle.
The second atom is taken to be the apex of the angle.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
The id of the third of the three atoms that define the angle.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
chem_comp_atom category.
Data items in the CHEM_COMP_ATOM category record details about
the atoms in a chemical component. Atomic coordinates can be
given for the components; specifying coordinates is an
alternative to specifying the structure of the component
via bonds, angles, planes, etc., in the appropriate
CHEM_COMP subcategories.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:chem_comp_atomCategory>
<PDBx:chem_comp_atom comp_id="phe" atom_id="N">
<PDBx:type_symbol>N</PDBx:type_symbol>
<PDBx:substruct_code>main</PDBx:substruct_code>
<PDBx:model_Cartn_x>1.20134</PDBx:model_Cartn_x>
<PDBx:model_Cartn_y>0.84658</PDBx:model_Cartn_y>
<PDBx:model_Cartn_z>0.00000</PDBx:model_Cartn_z>
</PDBx:chem_comp_atom>
<PDBx:chem_comp_atom comp_id="phe" atom_id="CA">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:substruct_code>main</PDBx:substruct_code>
<PDBx:model_Cartn_x>0.00000</PDBx:model_Cartn_x>
<PDBx:model_Cartn_y>0.00000</PDBx:model_Cartn_y>
<PDBx:model_Cartn_z>0.00000</PDBx:model_Cartn_z>
</PDBx:chem_comp_atom>
<PDBx:chem_comp_atom comp_id="phe" atom_id="C">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:substruct_code>main</PDBx:substruct_code>
<PDBx:model_Cartn_x>-1.25029</PDBx:model_Cartn_x>
<PDBx:model_Cartn_y>0.88107</PDBx:model_Cartn_y>
<PDBx:model_Cartn_z>0.00000</PDBx:model_Cartn_z>
</PDBx:chem_comp_atom>
<PDBx:chem_comp_atom comp_id="phe" atom_id="O">
<PDBx:type_symbol>O</PDBx:type_symbol>
<PDBx:substruct_code>main</PDBx:substruct_code>
<PDBx:model_Cartn_x>-2.18525</PDBx:model_Cartn_x>
<PDBx:model_Cartn_y>0.66029</PDBx:model_Cartn_y>
<PDBx:model_Cartn_z>-0.78409</PDBx:model_Cartn_z>
</PDBx:chem_comp_atom>
<PDBx:chem_comp_atom comp_id="phe" atom_id="CB">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:substruct_code>side</PDBx:substruct_code>
<PDBx:model_Cartn_x>0.00662</PDBx:model_Cartn_x>
<PDBx:model_Cartn_y>-1.03603</PDBx:model_Cartn_y>
<PDBx:model_Cartn_z>1.11081</PDBx:model_Cartn_z>
</PDBx:chem_comp_atom>
<PDBx:chem_comp_atom comp_id="phe" atom_id="CG">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:substruct_code>side</PDBx:substruct_code>
<PDBx:model_Cartn_x>0.03254</PDBx:model_Cartn_x>
<PDBx:model_Cartn_y>-0.49711</PDBx:model_Cartn_y>
<PDBx:model_Cartn_z>2.50951</PDBx:model_Cartn_z>
</PDBx:chem_comp_atom>
<PDBx:chem_comp_atom comp_id="phe" atom_id="CD1">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:substruct_code>side</PDBx:substruct_code>
<PDBx:model_Cartn_x>-1.15813</PDBx:model_Cartn_x>
<PDBx:model_Cartn_y>-0.12084</PDBx:model_Cartn_y>
<PDBx:model_Cartn_z>3.13467</PDBx:model_Cartn_z>
</PDBx:chem_comp_atom>
<PDBx:chem_comp_atom comp_id="phe" atom_id="CE1">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:substruct_code>side</PDBx:substruct_code>
<PDBx:model_Cartn_x>-1.15720</PDBx:model_Cartn_x>
<PDBx:model_Cartn_y>0.38038</PDBx:model_Cartn_y>
<PDBx:model_Cartn_z>4.42732</PDBx:model_Cartn_z>
</PDBx:chem_comp_atom>
<PDBx:chem_comp_atom comp_id="phe" atom_id="CZ">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:substruct_code>side</PDBx:substruct_code>
<PDBx:model_Cartn_x>0.05385</PDBx:model_Cartn_x>
<PDBx:model_Cartn_y>0.51332</PDBx:model_Cartn_y>
<PDBx:model_Cartn_z>5.11032</PDBx:model_Cartn_z>
</PDBx:chem_comp_atom>
<PDBx:chem_comp_atom comp_id="phe" atom_id="CE2">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:substruct_code>side</PDBx:substruct_code>
<PDBx:model_Cartn_x>1.26137</PDBx:model_Cartn_x>
<PDBx:model_Cartn_y>0.11613</PDBx:model_Cartn_y>
<PDBx:model_Cartn_z>4.50975</PDBx:model_Cartn_z>
</PDBx:chem_comp_atom>
<PDBx:chem_comp_atom comp_id="phe" atom_id="CD2">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:substruct_code>side</PDBx:substruct_code>
<PDBx:model_Cartn_x>1.23668</PDBx:model_Cartn_x>
<PDBx:model_Cartn_y>-0.38351</PDBx:model_Cartn_y>
<PDBx:model_Cartn_z>3.20288</PDBx:model_Cartn_z>
</PDBx:chem_comp_atom>
<PDBx:chem_comp_atom comp_id="val" atom_id="N">
<PDBx:type_symbol>N</PDBx:type_symbol>
<PDBx:substruct_code>main</PDBx:substruct_code>
<PDBx:model_Cartn_x>1.20134</PDBx:model_Cartn_x>
<PDBx:model_Cartn_y>0.84658</PDBx:model_Cartn_y>
<PDBx:model_Cartn_z>0.00000</PDBx:model_Cartn_z>
</PDBx:chem_comp_atom>
<PDBx:chem_comp_atom comp_id="val" atom_id="CA">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:substruct_code>main</PDBx:substruct_code>
<PDBx:model_Cartn_x>0.00000</PDBx:model_Cartn_x>
<PDBx:model_Cartn_y>0.00000</PDBx:model_Cartn_y>
<PDBx:model_Cartn_z>0.00000</PDBx:model_Cartn_z>
</PDBx:chem_comp_atom>
<PDBx:chem_comp_atom comp_id="val" atom_id="C">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:substruct_code>main</PDBx:substruct_code>
<PDBx:model_Cartn_x>-1.25029</PDBx:model_Cartn_x>
<PDBx:model_Cartn_y>0.88107</PDBx:model_Cartn_y>
<PDBx:model_Cartn_z>0.00000</PDBx:model_Cartn_z>
</PDBx:chem_comp_atom>
<PDBx:chem_comp_atom comp_id="val" atom_id="O">
<PDBx:type_symbol>O</PDBx:type_symbol>
<PDBx:substruct_code>main</PDBx:substruct_code>
<PDBx:model_Cartn_x>-2.18525</PDBx:model_Cartn_x>
<PDBx:model_Cartn_y>0.66029</PDBx:model_Cartn_y>
<PDBx:model_Cartn_z>-0.78409</PDBx:model_Cartn_z>
</PDBx:chem_comp_atom>
<PDBx:chem_comp_atom comp_id="val" atom_id="CB">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:substruct_code>side</PDBx:substruct_code>
<PDBx:model_Cartn_x>0.05260</PDBx:model_Cartn_x>
<PDBx:model_Cartn_y>-0.99339</PDBx:model_Cartn_y>
<PDBx:model_Cartn_z>1.17429</PDBx:model_Cartn_z>
</PDBx:chem_comp_atom>
<PDBx:chem_comp_atom comp_id="val" atom_id="CG1">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:substruct_code>side</PDBx:substruct_code>
<PDBx:model_Cartn_x>-0.13288</PDBx:model_Cartn_x>
<PDBx:model_Cartn_y>-0.31545</PDBx:model_Cartn_y>
<PDBx:model_Cartn_z>2.52668</PDBx:model_Cartn_z>
</PDBx:chem_comp_atom>
<PDBx:chem_comp_atom comp_id="val" atom_id="CG2">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:substruct_code>side</PDBx:substruct_code>
<PDBx:model_Cartn_x>-0.94265</PDBx:model_Cartn_x>
<PDBx:model_Cartn_y>-2.12930</PDBx:model_Cartn_y>
<PDBx:model_Cartn_z>0.99811</PDBx:model_Cartn_z>
</PDBx:chem_comp_atom>
</PDBx:chem_comp_atomCategory>
An alternative identifier for the atom. This data item would be
used in cases where alternative nomenclatures exist for labeling
atoms in a group.
The net integer charge assigned to this atom. This is the
formal charge assignment normally found in chemical diagrams.
for an ammonium nitrogen
1
for a chloride ion
-1
The x component of the coordinates for this atom in this
component specified as orthogonal angstroms. The choice of
reference axis frame for the coordinates is arbitrary.
The set of coordinates input for the entity here is intended to
correspond to the atomic model used to generate restraints for
structure refinement, and not to atom sites in the _atom_site
list.
The estimated standard deviation of
attribute model_Cartn_x in category chem_comp_atom.
The y component of the coordinates for this atom in this
component specified as orthogonal angstroms. The choice of
reference axis frame for the coordinates is arbitrary.
The set of coordinates input for the entity here is intended to
correspond to the atomic model used to generate restraints for
structure refinement, and not to atom sites in the _atom_site
list.
The estimated standard deviation of
attribute model_Cartn_y in category chem_comp_atom.
The x component of the coordinates for this atom in this
component specified as orthogonal angstroms. The choice of
reference axis frame for the coordinates is arbitrary.
The set of coordinates input for the entity here is intended to
correspond to the atomic model used to generate restraints for
structure refinement, and not to atom sites in the _atom_site
list.
The estimated standard deviation of
attribute model_Cartn_z in category chem_comp_atom.
The partial charge assigned to this atom.
This data item assigns the atom to a substructure of the
component, if appropriate.
This data item is a pointer to attribute symbol in category atom_type in the
ATOM_TYPE category.
This data item is a pointer to attribute id in category chem_comp in the CHEM_COMP
category.
The value of attribute atom_id in category chem_comp_atom must uniquely identify
each atom in each monomer in the CHEM_COMP_ATOM list.
The atom identifiers need not be unique over all atoms in the
data block; they need only be unique for each atom in a
component.
Note that this item need not be a number; it can be any unique
identifier.
Data items in the CHEM_COMP_BOND category record details about
the bonds between atoms in a chemical component. Target values
may be specified as bond orders, as a distance between the two
atoms, or both.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:chem_comp_bondCategory>
<PDBx:chem_comp_bond comp_id="phe" atom_id_1="N" atom_id_2="CA">
<PDBx:value_order>sing</PDBx:value_order>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_bond>
<PDBx:chem_comp_bond comp_id="phe" atom_id_1="CA" atom_id_2="C">
<PDBx:value_order>sing</PDBx:value_order>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_bond>
<PDBx:chem_comp_bond comp_id="phe" atom_id_1="C" atom_id_2="O">
<PDBx:value_order>doub</PDBx:value_order>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_bond>
<PDBx:chem_comp_bond comp_id="phe" atom_id_1="CB" atom_id_2="CA">
<PDBx:value_order>sing</PDBx:value_order>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_bond>
<PDBx:chem_comp_bond comp_id="phe" atom_id_1="CB" atom_id_2="CG">
<PDBx:value_order>sing</PDBx:value_order>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_bond>
<PDBx:chem_comp_bond comp_id="phe" atom_id_1="CG" atom_id_2="CD1">
<PDBx:value_order>arom</PDBx:value_order>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_bond>
<PDBx:chem_comp_bond comp_id="phe" atom_id_1="CD1" atom_id_2="CE1">
<PDBx:value_order>arom</PDBx:value_order>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_bond>
<PDBx:chem_comp_bond comp_id="phe" atom_id_1="CE1" atom_id_2="CZ">
<PDBx:value_order>arom</PDBx:value_order>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_bond>
<PDBx:chem_comp_bond comp_id="phe" atom_id_1="CZ" atom_id_2="CE2">
<PDBx:value_order>arom</PDBx:value_order>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_bond>
<PDBx:chem_comp_bond comp_id="phe" atom_id_1="CE2" atom_id_2="CD2">
<PDBx:value_order>arom</PDBx:value_order>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_bond>
<PDBx:chem_comp_bond comp_id="phe" atom_id_1="CD2" atom_id_2="CG">
<PDBx:value_order>arom</PDBx:value_order>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_bond>
<PDBx:chem_comp_bond comp_id="val" atom_id_1="N" atom_id_2="CA">
<PDBx:value_order>sing</PDBx:value_order>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_bond>
<PDBx:chem_comp_bond comp_id="val" atom_id_1="CA" atom_id_2="C">
<PDBx:value_order>sing</PDBx:value_order>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_bond>
<PDBx:chem_comp_bond comp_id="val" atom_id_1="C" atom_id_2="O">
<PDBx:value_order>doub</PDBx:value_order>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_bond>
<PDBx:chem_comp_bond comp_id="val" atom_id_1="CB" atom_id_2="CA">
<PDBx:value_order>sing</PDBx:value_order>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_bond>
<PDBx:chem_comp_bond comp_id="val" atom_id_1="CB" atom_id_2="CG1">
<PDBx:value_order>sing</PDBx:value_order>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_bond>
<PDBx:chem_comp_bond comp_id="val" atom_id_1="CB" atom_id_2="CG2">
<PDBx:value_order>sing</PDBx:value_order>
<PDBx:value_dist>x.xx</PDBx:value_dist>
</PDBx:chem_comp_bond>
</PDBx:chem_comp_bondCategory>
The value that should be taken as the target for the chemical
bond associated with the specified atoms, expressed as a
distance.
The estimated standard deviation of attribute value_dist in category chem_comp_bond.
The value that should be taken as the target for the chemical
bond associated with the specified atoms, expressed as a bond
order.
This data item is a pointer to attribute id in category chem_comp in the CHEM_COMP
category.
The id of the first of the two atoms that define the bond.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
The id of the second of the two atoms that define the bond.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
Data items in the CHEM_COMP_CHIR category provide detail about
the chiral centers in a chemical component. The atoms bonded
to the chiral atom are specified in the CHEM_COMP_CHIR_ATOM
category.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:chem_comp_chirCategory>
<PDBx:chem_comp_chir comp_id="phe" id="phe1">
<PDBx:atom_id>CA</PDBx:atom_id>
</PDBx:chem_comp_chir>
<PDBx:chem_comp_chir comp_id="val" id="val1">
<PDBx:atom_id>CA</PDBx:atom_id>
</PDBx:chem_comp_chir>
</PDBx:chem_comp_chirCategory>
The chiral configuration of the atom that is a chiral center.
The id of the atom that is a chiral center.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
The total number of atoms bonded to the atom specified by
attribute atom_id in category chem_comp_chir.
The number of non-hydrogen atoms bonded to the atom specified by
attribute atom_id in category chem_comp_chir.
A flag to indicate whether a chiral volume should match the
standard value in both magnitude and sign, or in magnitude only.
The chiral volume, V(c), for chiral centers that involve a chiral
atom bonded to three non-hydrogen atoms and one hydrogen atom.
V~c~ = V1 * (V2 X V3)
V1 = the vector distance from the atom specified by
attribute atom_id in category chem_comp_chir to the first atom in the
CHEM_COMP_CHIR_ATOM list
V2 = the vector distance from the atom specified by
attribute atom_id in category chem_comp_chir to the second atom in the
CHEM_COMP_CHIR_ATOM list
V3 = the vector distance from the atom specified by
attribute atom_id in category chem_comp_chir to the third atom in the
CHEM_COMP_CHIR_ATOM list
* = the vector dot product
X = the vector cross product
The estimated standard deviation of
attribute volume_three in category chem_comp_chir.
This data item is a pointer to attribute id in category chem_comp in the CHEM_COMP
category.
The value of attribute id in category chem_comp_chir must uniquely identify a record
in the CHEM_COMP_CHIR list.
Data items in the CHEM_COMP_CHIR_ATOM category enumerate the
atoms bonded to a chiral atom within a chemical component.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:chem_comp_chir_atomCategory>
<PDBx:chem_comp_chir_atom comp_id="phe" chir_id="1" atom_id="N"></PDBx:chem_comp_chir_atom>
<PDBx:chem_comp_chir_atom comp_id="phe" chir_id="1" atom_id="C"></PDBx:chem_comp_chir_atom>
<PDBx:chem_comp_chir_atom comp_id="phe" chir_id="1" atom_id="CB"></PDBx:chem_comp_chir_atom>
<PDBx:chem_comp_chir_atom comp_id="val" chir_id="1" atom_id="N"></PDBx:chem_comp_chir_atom>
<PDBx:chem_comp_chir_atom comp_id="val" chir_id="1" atom_id="C"></PDBx:chem_comp_chir_atom>
<PDBx:chem_comp_chir_atom comp_id="val" chir_id="1" atom_id="CB"></PDBx:chem_comp_chir_atom>
</PDBx:chem_comp_chir_atomCategory>
The estimated standard deviation of the position of this atom
from the plane defined by all of the atoms in the plane.
This data item is a pointer to attribute id in category chem_comp_chir in the
CHEM_COMP_CHIR category.
The id of an atom bonded to the chiral atom.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
This data item is a pointer to attribute id in category chem_comp in the
CHEM_COMP category.
Data items in the CHEM_COMP_LINK category give details about
the linkages between chemical components.
Example 1 - from nucleotide external reference dictionary Nucleic
Database Project 1997.
<PDBx:chem_comp_linkCategory>
<PDBx:chem_comp_link link_id="ribose_adenine">
<PDBx:type_comp_1>ribose</PDBx:type_comp_1>
<PDBx:type_comp_2>adenine</PDBx:type_comp_2>
<PDBx:details>
Defines the linkage between adenine base and ribose sugar</PDBx:details>
</PDBx:chem_comp_link>
</PDBx:chem_comp_linkCategory>
A description of special aspects of a linkage between
chemical components in the structure.
The type of the first of the two components joined by the
linkage.
This data item is a pointer to attribute type in category chem_comp in the CHEM_COMP
category.
The type of the second of the two components joined by the
linkage.
This data item is a pointer to attribute type in category chem_comp in the CHEM_COMP
category.
This data item is a pointer to attribute id in category chem_link in the
CHEM_LINK category.
Data items in the CHEM_COMP_PLANE category provide identifiers
for the planes in a chemical component. The atoms in the plane
are specified in the CHEM_COMP_PLANE_ATOM category.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:chem_comp_planeCategory>
<PDBx:chem_comp_plane comp_id="phe" id="phe1"></PDBx:chem_comp_plane>
</PDBx:chem_comp_planeCategory>
The total number of atoms in the plane.
The number of non-hydrogen atoms in the plane.
This data item is a pointer to attribute id in category chem_comp in the CHEM_COMP
category.
The value of attribute id in category chem_comp_plane must uniquely identify a record
in the CHEM_COMP_PLANE list.
Data items in the CHEM_COMP_PLANE_ATOM category enumerate the
atoms in a plane within a chemical component.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:chem_comp_plane_atomCategory>
<PDBx:chem_comp_plane_atom plane_id="phe1" comp_id="phe" atom_id="CB"></PDBx:chem_comp_plane_atom>
<PDBx:chem_comp_plane_atom plane_id="phe1" comp_id="phe" atom_id="CG"></PDBx:chem_comp_plane_atom>
<PDBx:chem_comp_plane_atom plane_id="phe1" comp_id="phe" atom_id="CD1"></PDBx:chem_comp_plane_atom>
<PDBx:chem_comp_plane_atom plane_id="phe1" comp_id="phe" atom_id="CE1"></PDBx:chem_comp_plane_atom>
<PDBx:chem_comp_plane_atom plane_id="phe1" comp_id="phe" atom_id="CZ"></PDBx:chem_comp_plane_atom>
<PDBx:chem_comp_plane_atom plane_id="phe1" comp_id="phe" atom_id="CE2"></PDBx:chem_comp_plane_atom>
<PDBx:chem_comp_plane_atom plane_id="phe1" comp_id="phe" atom_id="CD2"></PDBx:chem_comp_plane_atom>
</PDBx:chem_comp_plane_atomCategory>
This data item is the standard deviation of the
out-of-plane distance for this atom.
This data item is a pointer to attribute id in category chem_comp_plane in the
CHEM_COMP_PLANE category.
The id of an atom involved in the plane.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
This data item is a pointer to attribute id in category chem_comp in the CHEM_COMP
category.
Data items in the CHEM_COMP_TOR category record details about
the torsion angles in a chemical component. As torsion angles
can have more than one target value, the target values are
specified in the CHEM_COMP_TOR_VALUE category.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:chem_comp_torCategory>
<PDBx:chem_comp_tor comp_id="phe" id="phe_chi1">
<PDBx:atom_id_1>N</PDBx:atom_id_1>
<PDBx:atom_id_2>CA</PDBx:atom_id_2>
<PDBx:atom_id_3>CB</PDBx:atom_id_3>
<PDBx:atom_id_4>CG</PDBx:atom_id_4>
</PDBx:chem_comp_tor>
<PDBx:chem_comp_tor comp_id="phe" id="phe_chi2">
<PDBx:atom_id_1>CA</PDBx:atom_id_1>
<PDBx:atom_id_2>CB</PDBx:atom_id_2>
<PDBx:atom_id_3>CG</PDBx:atom_id_3>
<PDBx:atom_id_4>CD1</PDBx:atom_id_4>
</PDBx:chem_comp_tor>
<PDBx:chem_comp_tor comp_id="phe" id="phe_ring1">
<PDBx:atom_id_1>CB</PDBx:atom_id_1>
<PDBx:atom_id_2>CG</PDBx:atom_id_2>
<PDBx:atom_id_3>CD1</PDBx:atom_id_3>
<PDBx:atom_id_4>CE1</PDBx:atom_id_4>
</PDBx:chem_comp_tor>
<PDBx:chem_comp_tor comp_id="phe" id="phe_ring2">
<PDBx:atom_id_1>CB</PDBx:atom_id_1>
<PDBx:atom_id_2>CG</PDBx:atom_id_2>
<PDBx:atom_id_3>CD2</PDBx:atom_id_3>
<PDBx:atom_id_4>CE2</PDBx:atom_id_4>
</PDBx:chem_comp_tor>
<PDBx:chem_comp_tor comp_id="phe" id="phe_ring3">
<PDBx:atom_id_1>CG</PDBx:atom_id_1>
<PDBx:atom_id_2>CD1</PDBx:atom_id_2>
<PDBx:atom_id_3>CE1</PDBx:atom_id_3>
<PDBx:atom_id_4>CZ</PDBx:atom_id_4>
</PDBx:chem_comp_tor>
<PDBx:chem_comp_tor comp_id="phe" id="phe_ring4">
<PDBx:atom_id_1>CD1</PDBx:atom_id_1>
<PDBx:atom_id_2>CE1</PDBx:atom_id_2>
<PDBx:atom_id_3>CZ</PDBx:atom_id_3>
<PDBx:atom_id_4>CE2</PDBx:atom_id_4>
</PDBx:chem_comp_tor>
<PDBx:chem_comp_tor comp_id="phe" id="phe_ring5">
<PDBx:atom_id_1>CE1</PDBx:atom_id_1>
<PDBx:atom_id_2>CZ</PDBx:atom_id_2>
<PDBx:atom_id_3>CE2</PDBx:atom_id_3>
<PDBx:atom_id_4>CD2</PDBx:atom_id_4>
</PDBx:chem_comp_tor>
</PDBx:chem_comp_torCategory>
The id of the first of the four atoms that define the torsion
angle.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
The id of the second of the four atoms that define the torsion
angle.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
The id of the third of the four atoms that define the torsion
angle.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
The id of the fourth of the four atoms that define the torsion
angle.
This data item is a pointer to attribute atom_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
This data item is a pointer to attribute id in category chem_comp in the CHEM_COMP
category.
The value of attribute id in category chem_comp_tor must uniquely identify a
record in the CHEM_COMP_TOR list.
Data items in the CHEM_COMP_TOR_VALUE category record details
about the target values for the torsion angles enumerated in the
CHEM_COMP_TOR list. Target values may be specified as angles
in degrees, as a distance between the first and fourth atoms, or
both.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:chem_comp_tor_valueCategory>
<PDBx:chem_comp_tor_value tor_id="phe_chi1" comp_id="phe">
<PDBx:angle>-60.0</PDBx:angle>
<PDBx:dist>2.88</PDBx:dist>
</PDBx:chem_comp_tor_value>
<PDBx:chem_comp_tor_value tor_id="phe_chi1" comp_id="phe">
<PDBx:angle>180.0</PDBx:angle>
<PDBx:dist>3.72</PDBx:dist>
</PDBx:chem_comp_tor_value>
<PDBx:chem_comp_tor_value tor_id="phe_chi1" comp_id="phe">
<PDBx:angle>60.0</PDBx:angle>
<PDBx:dist>2.88</PDBx:dist>
</PDBx:chem_comp_tor_value>
<PDBx:chem_comp_tor_value tor_id="phe_chi2" comp_id="phe">
<PDBx:angle>90.0</PDBx:angle>
<PDBx:dist>3.34</PDBx:dist>
</PDBx:chem_comp_tor_value>
<PDBx:chem_comp_tor_value tor_id="phe_chi2" comp_id="phe">
<PDBx:angle>-90.0</PDBx:angle>
<PDBx:dist>3.34</PDBx:dist>
</PDBx:chem_comp_tor_value>
<PDBx:chem_comp_tor_value tor_id="phe_ring1" comp_id="phe">
<PDBx:angle>180.0</PDBx:angle>
<PDBx:dist>3.75</PDBx:dist>
</PDBx:chem_comp_tor_value>
<PDBx:chem_comp_tor_value tor_id="phe_ring2" comp_id="phe">
<PDBx:angle>180.0</PDBx:angle>
<PDBx:dist>3.75</PDBx:dist>
</PDBx:chem_comp_tor_value>
<PDBx:chem_comp_tor_value tor_id="phe_ring3" comp_id="phe">
<PDBx:angle>0.0</PDBx:angle>
<PDBx:dist>2.80</PDBx:dist>
</PDBx:chem_comp_tor_value>
<PDBx:chem_comp_tor_value tor_id="phe_ring4" comp_id="phe">
<PDBx:angle>0.0</PDBx:angle>
<PDBx:dist>2.80</PDBx:dist>
</PDBx:chem_comp_tor_value>
<PDBx:chem_comp_tor_value tor_id="phe_ring5" comp_id="phe">
<PDBx:angle>0.0</PDBx:angle>
<PDBx:dist>2.80</PDBx:dist>
</PDBx:chem_comp_tor_value>
</PDBx:chem_comp_tor_valueCategory>
A value that should be taken as a potential target value for the
torsion angle associated with the specified atoms, expressed in
degrees.
The estimated standard deviation of attribute angle in category chem_comp_tor_value.
A value that should be taken as a potential target value for the
torsion angle associated with the specified atoms, expressed as
the distance between the atoms specified by
_chem_comp_tor.atom_id_1 and _chem_comp_tor.atom_id_4 in the
referenced record in the CHEM_COMP_TOR list. Note that the
torsion angle cannot be fully specified by a distance (for
instance, a torsion angle of -60 will yield the same distance as
a 60 degree angle). However the distance specification can be
useful for refinement in situations in which the angle is already
close to the desired value.
The estimated standard deviation of
attribute dist_esd in category chem_comp_tor_value.
This data item is a pointer to attribute id in category chem_comp_tor in the
CHEM_COMP_TOR category.
This data item is a pointer to attribute comp_id in category chem_comp_atom in the
CHEM_COMP_ATOM category.
Data items in the CHEM_LINK category give details about
the linkages between chemical groups.
A description of special aspects of a linkage between
chemical components in the structure.
The value of attribute id in category chem_link must uniquely identify each
item in the CHEM_LINK list.
peptide
oligosaccharide 1,4
DNA
Data items in the CHEM_LINK_ANGLE category record details
about angles in a linkage between chemical groups.
Example 1 - Engh and Huber parameters as interpreted by J. P. Priestle
<PDBx:chem_link_angleCategory>
<PDBx:chem_link_angle link_id="PEPTIDE" atom_id_1="N" atom_id_2="CA" atom_id_3="C">
<PDBx:value_angle>111.2</PDBx:value_angle>
<PDBx:value_angle_esd>2.8</PDBx:value_angle_esd>
<PDBx:atom_1_comp_id>1</PDBx:atom_1_comp_id>
<PDBx:atom_2_comp_id>1</PDBx:atom_2_comp_id>
<PDBx:atom_3_comp_id>1</PDBx:atom_3_comp_id>
</PDBx:chem_link_angle>
<PDBx:chem_link_angle link_id="PEPTIDE" atom_id_1="CA" atom_id_2="C" atom_id_3="O">
<PDBx:value_angle>120.8</PDBx:value_angle>
<PDBx:value_angle_esd>1.7</PDBx:value_angle_esd>
<PDBx:atom_1_comp_id>1</PDBx:atom_1_comp_id>
<PDBx:atom_2_comp_id>1</PDBx:atom_2_comp_id>
<PDBx:atom_3_comp_id>1</PDBx:atom_3_comp_id>
</PDBx:chem_link_angle>
<PDBx:chem_link_angle link_id="PEPTIDE" atom_id_1="CA" atom_id_2="C" atom_id_3="N">
<PDBx:value_angle>116.2</PDBx:value_angle>
<PDBx:value_angle_esd>2.0</PDBx:value_angle_esd>
<PDBx:atom_1_comp_id>1</PDBx:atom_1_comp_id>
<PDBx:atom_2_comp_id>1</PDBx:atom_2_comp_id>
<PDBx:atom_3_comp_id>2</PDBx:atom_3_comp_id>
</PDBx:chem_link_angle>
<PDBx:chem_link_angle link_id="PEPTIDE" atom_id_1="O" atom_id_2="C" atom_id_3="N">
<PDBx:value_angle>123.0</PDBx:value_angle>
<PDBx:value_angle_esd>1.6</PDBx:value_angle_esd>
<PDBx:atom_1_comp_id>1</PDBx:atom_1_comp_id>
<PDBx:atom_2_comp_id>1</PDBx:atom_2_comp_id>
<PDBx:atom_3_comp_id>2</PDBx:atom_3_comp_id>
</PDBx:chem_link_angle>
<PDBx:chem_link_angle link_id="PEPTIDE" atom_id_1="C" atom_id_2="N" atom_id_3="CA">
<PDBx:value_angle>121.7</PDBx:value_angle>
<PDBx:value_angle_esd>1.8</PDBx:value_angle_esd>
<PDBx:atom_1_comp_id>1</PDBx:atom_1_comp_id>
<PDBx:atom_2_comp_id>2</PDBx:atom_2_comp_id>
<PDBx:atom_3_comp_id>2</PDBx:atom_3_comp_id>
</PDBx:chem_link_angle>
</PDBx:chem_link_angleCategory>
This data item indicates whether atom 1 is found in the first
or the second of the two components connected by the linkage.
This data item indicates whether atom 2 is found in the first
or the second of the two components connected by the linkage.
This data item indicates whether atom 3 is found in the first
or the second of the two components connected by the linkage.
The value that should be taken as the target value for the angle
associated with the specified atoms, expressed in degrees.
The estimated standard deviation of
attribute value_angle in category chem_link_angle.
The value that should be taken as the target value for the angle
associated with the specified atoms, expressed as the distance
between the atoms specified by attribute atom_id_1 in category chem_comp_angle and
attribute atom_id_3 in category chem_comp_angle.
The estimated standard deviation of
attribute value_dist_esd in category chem_comp_angle.
This data item is a pointer to attribute id in category chem_link in the CHEM_LINK
category.
The id of the first of the three atoms that define the angle.
An atom with this id must exist in the component of the type
specified by _chem_comp_link.type_1 (or _chem_comp_link.type_2,
where the appropriate data item is indated by the value of
attribute atom_1_comp_id) in category chem_comp_link.
The id of the second of the three atoms that define the angle.
The second atom is taken to be the apex of the angle.
An atom with this id must exist in the component of the type
specified by _chem_comp_link.type_1 (or _chem_comp_link.type_2,
where the appropriate data item is indated by the value of
attribute atom_2_comp_id) in category chem_comp_link.
The id of the third of the three atoms that define the angle.
An atom with this id must exist in the component of the type
specified by _chem_comp_link.type_1 (or _chem_comp_link.type_2,
where the appropriate data item is indated by the value of
attribute atom_3_comp_id) in category chem_comp_link.
Data items in the CHEM_LINK_BOND category record details about
bonds in a linkage between components in the chemical structure.
Example 1 - Engh and Huber parameters as interpreted by J. P. Priestle
<PDBx:chem_link_bondCategory>
<PDBx:chem_link_bond link_id="PEPTIDE" atom_id_1="N" atom_id_2="CA">
<PDBx:value_dist>1.458</PDBx:value_dist>
<PDBx:value_dist_esd>0.019</PDBx:value_dist_esd>
<PDBx:atom_1_comp_id>1</PDBx:atom_1_comp_id>
<PDBx:atom_2_comp_id>1</PDBx:atom_2_comp_id>
</PDBx:chem_link_bond>
<PDBx:chem_link_bond link_id="PEPTIDE" atom_id_1="CA" atom_id_2="C">
<PDBx:value_dist>1.525</PDBx:value_dist>
<PDBx:value_dist_esd>0.021</PDBx:value_dist_esd>
<PDBx:atom_1_comp_id>1</PDBx:atom_1_comp_id>
<PDBx:atom_2_comp_id>1</PDBx:atom_2_comp_id>
</PDBx:chem_link_bond>
<PDBx:chem_link_bond link_id="PEPTIDE" atom_id_1="C" atom_id_2="N">
<PDBx:value_dist>1.329</PDBx:value_dist>
<PDBx:value_dist_esd>0.014</PDBx:value_dist_esd>
<PDBx:atom_1_comp_id>1</PDBx:atom_1_comp_id>
<PDBx:atom_2_comp_id>2</PDBx:atom_2_comp_id>
</PDBx:chem_link_bond>
<PDBx:chem_link_bond link_id="PEPTIDE" atom_id_1="C" atom_id_2="O">
<PDBx:value_dist>1.231</PDBx:value_dist>
<PDBx:value_dist_esd>0.020</PDBx:value_dist_esd>
<PDBx:atom_1_comp_id>1</PDBx:atom_1_comp_id>
<PDBx:atom_2_comp_id>1</PDBx:atom_2_comp_id>
</PDBx:chem_link_bond>
</PDBx:chem_link_bondCategory>
This data item indicates whether atom 1 is found in the first
or the second of the two components connected by the linkage.
This data item indicates whether atom 2 is found in the first
or the second of the two chemical components connected by
the linkage.
The value that should be taken as the target for the chemical
bond associated with the specified atoms, expressed as a
distance.
The estimated standard deviation of
attribute value_dist_esd in category chem_link_bond.
The value that should be taken as the target for the chemical
bond associated with the specified atoms, expressed as a bond
order.
This data item is a pointer to attribute id in category chem_link in the CHEM_LINK
category.
The id of the first of the two atoms that define the bond.
As this data item does not point to a specific atom in a
specific chemical component, it is not a child in the
linkage sense.
The id of the second of the two atoms that define the bond.
As this data item does not point to a specific atom in a
specific component, it is not a child in the linkage sense.
Data items in the CHEM_LINK_CHIR category provide detail about
the chiral centers in a linkage between two chemical components.
The atoms bonded to the chiral atom are specified in the
CHEM_LINK_CHIR_ATOM category.
Example 1 - based on
This data item indicates whether the chiral atom is found in the
first or the second of the two component connected by the
linkage.
The chiral configuration of the atom that is a chiral center.
The id of the atom that is a chiral center.
As this data item does not point to a specific atom in a
specific chemical component, it is not a child in the linkage
sense.
The total number of atoms bonded to the atom specified by
attribute atom_id in category chem_link_chir.
The number of non-hydrogen atoms bonded to the atom specified by
attribute atom_id in category chem_link_chir.
A flag to indicate whether a chiral volume should match the
standard value in both magnitude and sign, or in magnitude only.
The chiral volume, V(c), for chiral centers that involve a chiral
atom bonded to three non-hydrogen atoms and one hydrogen atom.
V~c~ = V1 * (V2 X V3)
V1 = the vector distance from the atom specified by
attribute atom_id in category chem_link_chir to the first atom in the
CHEM_LINK_CHIR_ATOM list
V2 = the vector distance from the atom specified by
attribute atom_id in category chem_link_chir to the second atom in the
CHEM_LINK_CHIR_ATOM list
V3 = the vector distance from the atom specified by
attribute atom_id in category chem_link_chir to the third atom in the
CHEM_LINK_CHIR_ATOM list
* = the vector dot product
X = the vector cross product
The estimated standard deviation of
attribute volume_three in category chem_link_chir.
This data item is a pointer to attribute id in category chem_link in the CHEM_LINK
category.
The value of attribute id in category chem_link_chir must uniquely identify a record
in the CHEM_LINK_CHIR list.
Data items in the CHEM_LINK_CHIR_ATOM category enumerate the
atoms bonded to a chiral atom in a linkage between two
chemical components.
Example 1 - based on
This data item indicates whether the atom bonded to a chiral
atom is found in the first or the second of the two components
connected by the linkage.
The estimated standard deviation of the position of this atom
from the plane defined by all of the atoms in the plane.
This data item is a pointer to attribute id in category chem_link_chir in the
CHEM_LINK_CHIR category.
The id of an atom bonded to the chiral atom.
As this data item does not point to a specific atom in a
specific chemical component, it is not a child in the linkage
sense.
Data items in the CHEM_LINK_PLANE category provide identifiers
for the planes in a linkage between two chemical components.
The atoms in the plane are specified in the CHEM_LINK_PLANE_ATOM
category.
Example 1 - based on
The total number of atoms in the plane.
The number of non-hydrogen atoms in the plane.
This data item is a pointer to attribute id in category chem_link in the CHEM_LINK
category.
The value of attribute id in category chem_link_plane must uniquely identify a record
in the CHEM_LINK_PLANE list.
Data items in the CHEM_LINK_PLANE_ATOM category enumerate the
atoms in a plane in a linkage between two chemical components.
Example 1 - based on
This data item indicates whether the atom in a plane is found in
the first or the second of the two components connected by the
linkage.
This data item is a pointer to attribute id in category chem_link_plane in the
CHEM_LINK_PLANE category.
The id of an atom involved in the plane.
As this data item does not point to a specific atom in a
specific chemical component, it is not a child in the linkage
sense.
Data items in the CHEM_LINK_TOR category record details about
the torsion angles in a linkage between two chemical components.
As torsion angles can have more than one target value, the
target values are specified in the CHEM_LINK_TOR_VALUE category.
Example 1 - based on
This data item indicates whether atom 1 is found in the first
or the second of the two components connected by the linkage.
This data item indicates whether atom 2 is found in the first
or the second of the two components connected by the linkage.
This data item indicates whether atom 3 is found in the first
or the second of the two components connected by the linkage.
This data item indicates whether atom 4 is found in the first
or the second of the two components connected by the linkage.
The id of the first of the four atoms that define the torsion
angle.
As this data item does not point to a specific atom in a
specific chemical component, it is not a child in the linkage
sense.
The id of the second of the four atoms that define the torsion
angle.
As this data item does not point to a specific atom in a
specific chemical component, it is not a child in the linkage
sense.
The id of the third of the four atoms that define the torsion
angle.
As this data item does not point to a specific atom in a
specific chemical component, it is not a child in the linkage
sense.
The id of the fourth of the four atoms that define the torsion
angle.
As this data item does not point to a specific atom in a
specific chemical component, it is not a child in the linkage
sense.
This data item is a pointer to attribute id in category chem_link in the CHEM_LINK
category.
The value of attribute id in category chem_link_tor must uniquely identify a
record in the CHEM_LINK_TOR list.
Data items in the CHEM_LINK_TOR_VALUE category record details
about the target values for the torsion angles enumerated in the
CHEM_LINK_TOR list. Target values may be specified as angles
in degrees, as a distance between the first and fourth atoms, or
both.
Example 1 - based on
A value that should be taken as a potential target value for the
torsion angle associated with the specified atoms, expressed in
degrees.
The estimated standard deviation of attribute angle in category chem_link_tor_value.
A value that should be taken as a potential target value for the
torsion angle associated with the specified atoms, expressed as
the distance between the atoms specified by
_chem_link_tor.atom_id_1 and _chem_link_tor.atom_id_4 in the
referenced record in the CHEM_LINK_TOR list. Note that the
torsion angle cannot be fully specified by a distance (for
instance, a torsion angle of -60 will yield the same distance as
a 60 degree angle). However the distance specification can be
useful for refinement in situations in which the angle is already
close to the desired value.
The estimated standard deviation of
attribute dist_esd in category chem_link_tor_value.
This data item is a pointer to attribute id in category chem_link_tor in the
CHEM_LINK_TOR category.
Data items in the CHEMICAL category would not in general be
used in a macromolecular CIF. See instead the ENTITY data
items.
Data items in the CHEMICAL category record details about the
composition and chemical properties of the compounds. The
formula data items must agree with those that specify the
density, unit-cell and Z values.
Example 1 - based on data set 9597gaus of Alyea, Ferguson & Kannan [(1996).
Acta Cryst. C52, 765-767].
<PDBx:chemicalCategory>
<PDBx:chemical entry_id="9597gaus">
<PDBx:name_systematic>trans-bis(tricyclohexylphosphine)tetracarbonylmolybdenum(0)</PDBx:name_systematic>
</PDBx:chemical>
</PDBx:chemicalCategory>
Description of the source of the compound under study, or of the
parent molecule if a simple derivative is studied. This includes
the place of discovery for minerals or the actual source of a
natural product.
From Norilsk (USSR)
Extracted from the bark of Cinchona Naturalis
The temperature in kelvins at which a crystalline solid changes
to a liquid.
Trivial name by which the compound is commonly known.
1-bromoestradiol
Mineral name accepted by the International Mineralogical
Association. Use only for natural minerals. See also
attribute compound_source in category chemical.
chalcopyrite
Commonly used structure-type name. Usually only applied to
minerals or inorganic compounds.
perovskite
sphalerite
A15
IUPAC or Chemical Abstracts full name of compound.
1-bromoestra-1,3,5(10)-triene-3,17\b-diol
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the CHEMICAL_CONN_ATOM category would not, in
general, be used in a macromolecular CIF. See instead the
ENTITY data items.
Data items in the CHEMICAL_CONN_ATOM and CHEMICAL_CONN_BOND
categories record details about the 2D chemical structure of the
molecular species. They allow a 2D chemical diagram to be
reconstructed for use in a publication or in a database search
for structural and substructural relationships.
The CHEMICAL_CONN_ATOM data items provide information about the
chemical properties of the atoms in the structure. In cases
where crystallographic and molecular symmetry elements coincide
they must also contain symmetry-generated atoms, so that the
CHEMICAL_CONN_ATOM and CHEMICAL_CONN_BOND data items will always
describe a complete chemical entity.
Example 1 - based on data set DPTD of Yamin, Suwandi, Fun, Sivakumar &
bin Shawkataly [(1996). Acta Cryst. C52, 951-953].
<PDBx:chemical_conn_atomCategory>
<PDBx:chemical_conn_atom number="1">
<PDBx:type_symbol>S</PDBx:type_symbol>
<PDBx:display_x>.39</PDBx:display_x>
<PDBx:display_y>.81</PDBx:display_y>
<PDBx:NCA>1</PDBx:NCA>
<PDBx:NH>0</PDBx:NH>
</PDBx:chemical_conn_atom>
<PDBx:chemical_conn_atom number="2">
<PDBx:type_symbol>S</PDBx:type_symbol>
<PDBx:display_x>.39</PDBx:display_x>
<PDBx:display_y>.96</PDBx:display_y>
<PDBx:NCA>2</PDBx:NCA>
<PDBx:NH>0</PDBx:NH>
</PDBx:chemical_conn_atom>
<PDBx:chemical_conn_atom number="3">
<PDBx:type_symbol>N</PDBx:type_symbol>
<PDBx:display_x>.14</PDBx:display_x>
<PDBx:display_y>.88</PDBx:display_y>
<PDBx:NCA>3</PDBx:NCA>
<PDBx:NH>0</PDBx:NH>
</PDBx:chemical_conn_atom>
<PDBx:chemical_conn_atom number="4">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:display_x>.33</PDBx:display_x>
<PDBx:display_y>.88</PDBx:display_y>
<PDBx:NCA>3</PDBx:NCA>
<PDBx:NH>0</PDBx:NH>
</PDBx:chemical_conn_atom>
<PDBx:chemical_conn_atom number="5">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:display_x>.11</PDBx:display_x>
<PDBx:display_y>.96</PDBx:display_y>
<PDBx:NCA>2</PDBx:NCA>
<PDBx:NH>2</PDBx:NH>
</PDBx:chemical_conn_atom>
<PDBx:chemical_conn_atom number="6">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:display_x>.03</PDBx:display_x>
<PDBx:display_y>.96</PDBx:display_y>
<PDBx:NCA>2</PDBx:NCA>
<PDBx:NH>2</PDBx:NH>
</PDBx:chemical_conn_atom>
<PDBx:chemical_conn_atom number="7">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:display_x>.03</PDBx:display_x>
<PDBx:display_y>.80</PDBx:display_y>
<PDBx:NCA>2</PDBx:NCA>
<PDBx:NH>2</PDBx:NH>
</PDBx:chemical_conn_atom>
<PDBx:chemical_conn_atom number="8">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:display_x>.11</PDBx:display_x>
<PDBx:display_y>.80</PDBx:display_y>
<PDBx:NCA>2</PDBx:NCA>
<PDBx:NH>2</PDBx:NH>
</PDBx:chemical_conn_atom>
<PDBx:chemical_conn_atom number="9">
<PDBx:type_symbol>S</PDBx:type_symbol>
<PDBx:display_x>.54</PDBx:display_x>
<PDBx:display_y>.81</PDBx:display_y>
<PDBx:NCA>1</PDBx:NCA>
<PDBx:NH>0</PDBx:NH>
</PDBx:chemical_conn_atom>
<PDBx:chemical_conn_atom number="10">
<PDBx:type_symbol>S</PDBx:type_symbol>
<PDBx:display_x>.54</PDBx:display_x>
<PDBx:display_y>.96</PDBx:display_y>
<PDBx:NCA>2</PDBx:NCA>
<PDBx:NH>0</PDBx:NH>
</PDBx:chemical_conn_atom>
<PDBx:chemical_conn_atom number="11">
<PDBx:type_symbol>N</PDBx:type_symbol>
<PDBx:display_x>.80</PDBx:display_x>
<PDBx:display_y>.88</PDBx:display_y>
<PDBx:NCA>3</PDBx:NCA>
<PDBx:NH>0</PDBx:NH>
</PDBx:chemical_conn_atom>
<PDBx:chemical_conn_atom number="12">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:display_x>.60</PDBx:display_x>
<PDBx:display_y>.88</PDBx:display_y>
<PDBx:NCA>3</PDBx:NCA>
<PDBx:NH>0</PDBx:NH>
</PDBx:chemical_conn_atom>
<PDBx:chemical_conn_atom number="13">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:display_x>.84</PDBx:display_x>
<PDBx:display_y>.96</PDBx:display_y>
<PDBx:NCA>2</PDBx:NCA>
<PDBx:NH>2</PDBx:NH>
</PDBx:chemical_conn_atom>
<PDBx:chemical_conn_atom number="14">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:display_x>.91</PDBx:display_x>
<PDBx:display_y>.96</PDBx:display_y>
<PDBx:NCA>2</PDBx:NCA>
<PDBx:NH>2</PDBx:NH>
</PDBx:chemical_conn_atom>
<PDBx:chemical_conn_atom number="15">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:display_x>.91</PDBx:display_x>
<PDBx:display_y>.80</PDBx:display_y>
<PDBx:NCA>2</PDBx:NCA>
<PDBx:NH>2</PDBx:NH>
</PDBx:chemical_conn_atom>
<PDBx:chemical_conn_atom number="16">
<PDBx:type_symbol>C</PDBx:type_symbol>
<PDBx:display_x>.84</PDBx:display_x>
<PDBx:display_y>.80</PDBx:display_y>
<PDBx:NCA>2</PDBx:NCA>
<PDBx:NH>2</PDBx:NH>
</PDBx:chemical_conn_atom>
</PDBx:chemical_conn_atomCategory>
The number of connected atoms excluding terminal hydrogen atoms.
The total number of hydrogen atoms attached to this atom,
regardless of whether they are included in the refinement or
the ATOM_SITE list. This number is the same as
attribute attached_hydrogens in category atom_site only if none of the hydrogen
atoms appear in the ATOM_SITE list.
The net integer charge assigned to this atom. This is the
formal charge assignment normally found in chemical diagrams.
for an ammonium nitrogen
1
for a chloride ion
-1
The 2D Cartesian x coordinate of the position of this atom in a
recognisable chemical diagram. The coordinate origin is at the
lower left corner, the x axis is horizontal and the y axis
is vertical. The coordinates must lie in the range 0.0 to 1.0.
These coordinates can be obtained from projections of a suitable
uncluttered view of the molecular structure. If absent, values
will be assigned by the journal or database staff.
The 2D Cartesian y coordinate of the position of this atom in a
recognisable chemical diagram. The coordinate origin is at the
lower left corner, the x axis is horizontal and the y axis
is vertical. The coordinates must lie in the range 0.0 to 1.0.
These coordinates can be obtained from projections of a suitable
uncluttered view of the molecular structure. If absent, values
will be assigned by the journal or database staff.
This data item is a pointer to attribute symbol in category atom_type in the
ATOM_TYPE category.
The chemical sequence number to be associated with this atom.
Within an ATOM_SITE list this number must match with one of
the attribute chemical_conn_number in category atom_site values.
Data items in the CHEMICAL_CONN_BOND category would not, in
general, be used in a macromolecular CIF. See instead the
ENTITY data items.
Data items in the CHEMICAL_CONN_ATOM and CHEMICAL_CONN_BOND
categories record details about the 2D chemical structure of the
molecular species. They allow a 2D chemical diagram to be
reconstructed for use in a publication or in a database search
for structural and substructural relationships.
The CHEMICAL_CONN_BOND data items specify the connections
between the atoms in the CHEMICAL_CONN_ATOM list and the nature
of the chemical bond between these atoms.
Example 1 - based on data set DPTD of Yamin, Suwandi, Fun, Sivakumar &
bin Shawkataly [(1996). Acta Cryst. C52, 951-953].
<PDBx:chemical_conn_bondCategory>
<PDBx:chemical_conn_bond atom_1="4" atom_2="1">
<PDBx:type>doub</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="4" atom_2="3">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="4" atom_2="2">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="5" atom_2="3">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="6" atom_2="5">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="7" atom_2="6">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="8" atom_2="7">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="8" atom_2="3">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="10" atom_2="2">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="12" atom_2="9">
<PDBx:type>doub</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="12" atom_2="11">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="12" atom_2="10">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="13" atom_2="11">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="14" atom_2="13">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="15" atom_2="14">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="16" atom_2="15">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="16" atom_2="11">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="17" atom_2="5">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="18" atom_2="5">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="19" atom_2="6">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="20" atom_2="6">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="21" atom_2="7">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="22" atom_2="7">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="23" atom_2="8">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="24" atom_2="8">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="25" atom_2="13">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="26" atom_2="13">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="27" atom_2="14">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="28" atom_2="14">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="29" atom_2="15">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="30" atom_2="15">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="31" atom_2="16">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
<PDBx:chemical_conn_bond atom_1="32" atom_2="16">
<PDBx:type>sing</PDBx:type>
</PDBx:chemical_conn_bond>
</PDBx:chemical_conn_bondCategory>
The chemical bond type associated with the connection between
the two sites attribute atom_1 in category chemical_conn_bond and
attribute atom_2 in category chemical_conn_bond.
This data item is a pointer to attribute number in category chemical_conn_atom in the
CHEMICAL_CONN_ATOM category.
This data item is a pointer to attribute number in category chemical_conn_atom in the
CHEMICAL_CONN_ATOM category.
Data items in the CHEMICAL_FORMULA category would not, in
general, be used in a macromolecular CIF. See instead the
ENTITY data items.
Data items in the CHEMICAL_FORMULA category specify the
composition and chemical properties of the compound. The formula
data items must agree with those that specify the density, unit
cell and Z values.
The following rules apply to the construction of the data items
_chemical_formula.analytical, _chemical_formula.structural and
attribute sum in category chemical_formula. For the data item
attribute moiety in category chemical_formula the formula construction is broken up
into residues or moieties, i.e. groups of atoms that form a
molecular unit or molecular ion. The rules given below apply
within each moiety but different requirements apply to the way
that moieties are connected (see attribute moiety).
in category chemical_formula
1. Only recognised element symbols may be used.
2. Each element symbol is followed by a 'count' number. A count
of '1' may be omitted.
3. A space or parenthesis must separate each cluster of (element
symbol + count).
4. Where a group of elements is enclosed in parentheses, the
multiplier for the group must follow the closing parentheses.
That is, all element and group multipliers are assumed to be
printed as subscripted numbers. [An exception to this rule
exists for attribute moiety in category chemical_formula formulae where pre- and
post-multipliers are permitted for molecular units].
5. Unless the elements are ordered in a manner that corresponds
to their chemical structure, as in
attribute structural in category chemical_formula the order of the elements within
any group or moiety should be: C, H followed by the other
elements in alphabetical order of their symbol. This is the
'Hill' system used by Chemical Abstracts. This ordering is
used in _chemical_formula.moiety and _chemical_formula.sum.
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer [(1991).
Acta Cryst. C47, 2276-2277].
<PDBx:chemical_formulaCategory>
<PDBx:chemical_formula entry_id="TOZ">
<PDBx:moiety>C18 H25 N O3</PDBx:moiety>
<PDBx:sum>C18 H25 N O3</PDBx:sum>
<PDBx:weight>303.40</PDBx:weight>
</PDBx:chemical_formula>
</PDBx:chemical_formulaCategory>
Formula determined by standard chemical analysis including trace
elements. See the CHEMICAL_FORMULA category description for
rules for writing chemical formulae. Parentheses are used only
for standard uncertainties (e.s.d.'s).
Fe2.45(2) Ni1.60(3) S4
Formula expressed in conformance with IUPAC rules for inorganic
and metal-organic compounds where these conflict with the rules
for any other CHEMICAL_FORMULA entries. Typically used for
formatting a formula in accordance with journal rules. This
should appear in the data block in addition to the most
appropriate of the other CHEMICAL_FORMULA data names.
Ref: IUPAC (1990). Nomenclature of Inorganic Chemistry.
Oxford: Blackwell Scientific Publications.
[Co Re (C12 H22 P)2 (C O)6].0.5C H3 O H
Formula with each discrete bonded residue or ion shown as a
separate moiety. See the CHEMICAL_FORUMULA category description
for rules for writing chemical formulae. In addition to the
general formulae requirements, the following rules apply:
1. Moieties are separated by commas ','.
2. The order of elements within a moiety follows general rule
5 in the CHEMICAL_FORMULA category description.
3. Parentheses are not used within moieties but may surround
a moiety. Parentheses may not be nested.
4. Charges should be placed at the end of the moiety. The
charge '+' or '-' may be preceded by a numerical multiplier
and should be separated from the last (element symbol +
count) by a space. Pre- or post-multipliers may be used for
individual moieties.
C7 H4 Cl Hg N O3 S
C12 H17 N4 O S 1+, C6 H2 N3 O7 1-
C12 H16 N2 O6, 5(H2 O1)
(Cd 2+)3, (C6 N6 Cr 3-)2, 2(H2 O)
See the CHEMICAL_FORMULA category description for the rules for
writing chemical formulae for inorganics, organometallics, metal
complexes etc., in which bonded groups are preserved as
discrete entities within parentheses, with post-multipliers as
required. The order of the elements should give as much
information as possible about the chemical structure.
Parentheses may be used and nested as required. This formula
should correspond to the structure as actually reported, i.e.
trace elements not included in atom type and atom site data
should not be included in this formula (see also
attribute analytical) in category chemical_formula.
Ca ((Cl O3)2 O)2 (H2 O)6
(Pt (N H3)2 (C5 H7 N3 O)2) (Cl O4)2
See the CHEMICAL_FORMULA category description for the rules
for writing chemical formulae in which all discrete bonded
residues and ions are summed over the constituent elements,
following the ordering given in general rule 5 in the
CHEMICAL_FORMULA category description. Parentheses are not
normally used.
C18 H19 N7 O8 S
Formula mass in daltons. This mass should correspond to the
formulae given under attribute structural in category chemical_formula
chemical_formula.moiety or attribute sum in category chemical_formula and,
together with the Z value and cell parameters, should
yield the density given as attribute density_diffrn in category exptl_crystal.
Formula mass in daltons measured by a non-diffraction experiment.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the CITATION category record details about the
literature cited relevant to the contents of the data block.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:citationCategory>
<PDBx:citation id="primary">
<PDBx:coordinate_linkage>yes</PDBx:coordinate_linkage>
<PDBx:title> Crystallographic analysis of a complex between human immunodeficiency
virus type 1 protease and acetyl-pepstatin at 2.0-Angstroms resolution.</PDBx:title>
<PDBx:country>US</PDBx:country>
<PDBx:journal_abbrev>J. Biol. Chem.</PDBx:journal_abbrev>
<PDBx:journal_volume>265</PDBx:journal_volume>
<PDBx:page_first>14209</PDBx:page_first>
<PDBx:page_last>14219</PDBx:page_last>
<PDBx:year>1990</PDBx:year>
<PDBx:journal_id_ASTM>HBCHA3</PDBx:journal_id_ASTM>
<PDBx:journal_id_ISSN>0021-9258</PDBx:journal_id_ISSN>
<PDBx:journal_id_CSD>071</PDBx:journal_id_CSD>
<PDBx:details> The publication that directly relates to this coordinate set.</PDBx:details>
</PDBx:citation>
<PDBx:citation id="2">
<PDBx:coordinate_linkage>no</PDBx:coordinate_linkage>
<PDBx:title> Three-dimensional structure of aspartyl-protease from human
immunodeficiency virus HIV-1.</PDBx:title>
<PDBx:country>UK</PDBx:country>
<PDBx:journal_abbrev>Nature</PDBx:journal_abbrev>
<PDBx:journal_volume>337</PDBx:journal_volume>
<PDBx:page_first>615</PDBx:page_first>
<PDBx:page_last>619</PDBx:page_last>
<PDBx:year>1989</PDBx:year>
<PDBx:journal_id_ASTM>NATUAS</PDBx:journal_id_ASTM>
<PDBx:journal_id_ISSN>0028-0836</PDBx:journal_id_ISSN>
<PDBx:journal_id_CSD>006</PDBx:journal_id_CSD>
<PDBx:details> Determination of the structure of the unliganded enzyme.</PDBx:details>
</PDBx:citation>
<PDBx:citation id="3">
<PDBx:coordinate_linkage>no</PDBx:coordinate_linkage>
<PDBx:title> Crystallization of the aspartylprotease from human immunodeficiency
virus, HIV-1.</PDBx:title>
<PDBx:country>US</PDBx:country>
<PDBx:journal_abbrev>J. Biol. Chem.</PDBx:journal_abbrev>
<PDBx:journal_volume>264</PDBx:journal_volume>
<PDBx:page_first>1919</PDBx:page_first>
<PDBx:page_last>1921</PDBx:page_last>
<PDBx:year>1989</PDBx:year>
<PDBx:journal_id_ASTM>HBCHA3</PDBx:journal_id_ASTM>
<PDBx:journal_id_ISSN>0021-9258</PDBx:journal_id_ISSN>
<PDBx:journal_id_CSD>071</PDBx:journal_id_CSD>
<PDBx:details> Crystallization of the unliganded enzyme.</PDBx:details>
</PDBx:citation>
<PDBx:citation id="4">
<PDBx:coordinate_linkage>no</PDBx:coordinate_linkage>
<PDBx:title> Human immunodeficiency virus protease. Bacterial expression and
characterization of the purified aspartic protease.</PDBx:title>
<PDBx:country>US</PDBx:country>
<PDBx:journal_abbrev>J. Biol. Chem.</PDBx:journal_abbrev>
<PDBx:journal_volume>264</PDBx:journal_volume>
<PDBx:page_first>2307</PDBx:page_first>
<PDBx:page_last>2312</PDBx:page_last>
<PDBx:year>1989</PDBx:year>
<PDBx:journal_id_ASTM>HBCHA3</PDBx:journal_id_ASTM>
<PDBx:journal_id_ISSN>0021-9258</PDBx:journal_id_ISSN>
<PDBx:journal_id_CSD>071</PDBx:journal_id_CSD>
<PDBx:details> Expression and purification of the enzyme.</PDBx:details>
</PDBx:citation>
</PDBx:citationCategory>
Abstract for the citation. This is used most when the
citation is extracted from a bibliographic database that
contains full text or abstract information.
The Chemical Abstracts Service (CAS) abstract identifier;
relevant for journal articles.
The International Standard Book Number (ISBN) code assigned to
the book cited; relevant for book chapters.
The name of the publisher of the citation; relevant
for book chapters.
John Wiley and Sons
The location of the publisher of the citation; relevant
for book chapters.
London
The title of the book in which the citation appeared; relevant
for book chapters.
attribute coordinate_linkage in category citation states whether or not this citation
is concerned with precisely the set of coordinates given in the
data block. If, for instance, the publication described the same
structure, but the coordinates had undergone further refinement
prior to creation of the data block, the value of this data item
would be 'no'.
The country of publication; relevant for both journal articles
and book chapters.
Ascession number used by Medline to categorize a specific
bibliographic entry.
89064067
A description of special aspects that describe the relationship
of the contents of the data block to the literature item cited.
citation relates to this precise
coordinate set
citation relates to earlier low-resolution
structure
citation relates to further refinement of
structure reported in citation 2
Abbreviated name of the journal cited as given in the Chemical
Abstracts Service Source Index.
J. Mol. Biol.
Full name of the journal cited; relevant for journal articles.
Journal of Molecular Biology
The American Society for the Testing of Materials (ASTM) code
assigned to the journal cited (also referred to as the CODEN
designator of the Chemical Abstracts Service); relevant for
journal articles.
The Cambridge Structural Database (CSD) code assigned to the
journal cited; relevant for journal articles. This is also the
system used at the Brookhaven Protein Data Bank (PDB).
070
The International Standard Serial Number (ISSN) code assigned to
the journal cited; relevant for journal articles.
Issue number of the journal cited; relevant for journal
articles.
2
Volume number of the journal cited; relevant for journal
articles.
174
Language in which the citation appears.
german
The first page of the citation; relevant for journal
articles and book chapters.
The last page of the citation; relevant for journal
articles and book chapters.
Ascession number used by PubMed to categorize a specific
bibliographic entry.
12627512
The title of the citation; relevant for both journal articles
and book chapters.
Structure of Diferric Duck Ovatransferrin
at 2.35 \%A Resolution.
The year of the citation; relevant for both journal articles
and book chapters.
1984
The value of attribute id in category citation must uniquely identify a record in the
CITATION list.
The attribute id in category citation 'primary' should be used to indicate the
citation that the author(s) consider to be the most pertinent to
the contents of the data block.
Note that this item need not be a number; it can be any unique
identifier.
primary
1
2
Data items in the CITATION_AUTHOR category record details
about the authors associated with the citations in the
CITATION list.
Example 1 - based on PDB entry 5HVP and/or laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:citation_authorCategory>
<PDBx:citation_author citation_id="primary" name="Fitzgerald, P.M.D.">
<PDBx:ordinal>1</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="primary" name="McKeever, B.M.">
<PDBx:ordinal>2</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="primary" name="Van Middlesworth, J.F.">
<PDBx:ordinal>3</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="primary" name="Springer, J.P.">
<PDBx:ordinal>4</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="primary" name="Heimbach, J.C.">
<PDBx:ordinal>5</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="primary" name="Leu, C.-T.">
<PDBx:ordinal>6</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="primary" name="Herber, W.K.">
<PDBx:ordinal>7</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="primary" name="Dixon, R.A.F.">
<PDBx:ordinal>8</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="primary" name="Darke, P.L.">
<PDBx:ordinal>9</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="2" name="Navia, M.A.">
<PDBx:ordinal>1</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="2" name="Fitzgerald, P.M.D.">
<PDBx:ordinal>2</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="2" name="McKeever, B.M.">
<PDBx:ordinal>3</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="2" name="Leu, C.-T.">
<PDBx:ordinal>4</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="2" name="Heimbach, J.C.">
<PDBx:ordinal>5</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="2" name="Herber, W.K.">
<PDBx:ordinal>6</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="2" name="Sigal, I.S.">
<PDBx:ordinal>7</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="2" name="Darke, P.L.">
<PDBx:ordinal>8</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="2" name="Springer, J.P.">
<PDBx:ordinal>9</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="3" name="McKeever, B.M.">
<PDBx:ordinal>1</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="3" name="Navia, M.A.">
<PDBx:ordinal>2</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="3" name="Fitzgerald, P.M.D.">
<PDBx:ordinal>3</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="3" name="Springer, J.P.">
<PDBx:ordinal>4</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="3" name="Leu, C.-T.">
<PDBx:ordinal>5</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="3" name="Heimbach, J.C.">
<PDBx:ordinal>6</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="3" name="Herber, W.K.">
<PDBx:ordinal>7</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="3" name="Sigal, I.S.">
<PDBx:ordinal>8</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="3" name="Darke, P.L.">
<PDBx:ordinal>9</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="4" name="Darke, P.L.">
<PDBx:ordinal>1</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="4" name="Leu, C.-T.">
<PDBx:ordinal>2</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="4" name="Davis, L.J.">
<PDBx:ordinal>3</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="4" name="Heimbach, J.C.">
<PDBx:ordinal>4</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="4" name="Diehl, R.E.">
<PDBx:ordinal>5</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="4" name="Hill, W.S.">
<PDBx:ordinal>6</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="4" name="Dixon, R.A.F.">
<PDBx:ordinal>7</PDBx:ordinal>
</PDBx:citation_author>
<PDBx:citation_author citation_id="4" name="Sigal, I.S.">
<PDBx:ordinal>8</PDBx:ordinal>
</PDBx:citation_author>
</PDBx:citation_authorCategory>
This data item defines the order of the author's name in the
list of authors of a citation.
This data item is a pointer to attribute id in category citation in the CITATION
category.
Name of an author of the citation; relevant for both journal
articles and book chapters.
The family name(s), followed by a comma and including any
dynastic components, precedes the first name(s) or initial(s).
Bleary, Percival R.
O'Neil, F.K.
Van den Bossche, G.
Yang, D.-L.
Simonov, Yu.A
Data items in the CITATION_EDITOR category record details
about the editor associated with book chapter citations in
the CITATION list.
Example 1 - example is completely hypothetical
<PDBx:citation_editorCategory>
<PDBx:citation_editor citation_id="5" name="McKeever, B.M."></PDBx:citation_editor>
<PDBx:citation_editor citation_id="5" name="Navia, M.A."></PDBx:citation_editor>
<PDBx:citation_editor citation_id="5" name="Fitzgerald, P.M.D."></PDBx:citation_editor>
<PDBx:citation_editor citation_id="5" name="Springer, J.P."></PDBx:citation_editor>
</PDBx:citation_editorCategory>
This data item defines the order of the editor's name in the
list of editors of a citation.
This data item is a pointer to attribute id in category citation in the CITATION
category.
Names of an editor of the citation; relevant for book chapters.
The family name(s), followed by a comma and including any
dynastic components, precedes the first name(s) or initial(s).
Bleary, Percival R.
O'Neil, F.K.
Van den Bossche, G.
Yang, D.-L.
Simonov, Yu.A
Data items in the COMPUTING category record details about the
computer programs used in the crystal structure analysis.
Data items in this category would not, in general, be used in
a macromolecular CIF. The category SOFTWARE, which allows
for a more detailed description of computer programs and
their attribues, would be used instead.
Example 1 - Rodr\'iguez-Romera, Ruiz-P\'erez and Solans [(1996). Acta
Cryst. C52, 1415-1417].
<PDBx:computingCategory>
<PDBx:computing>
<PDBx:data_collection>CAD-4 (Enraf-Nonius, 1989)</PDBx:data_collection>
<PDBx:cell_refinement>CAD-4 (Enraf-Nonius, 1989)</PDBx:cell_refinement>
<PDBx:data_reduction>CFEO (Solans, 1978)</PDBx:data_reduction>
<PDBx:structure_solution>SHELXS86 (Sheldrick, 1990)</PDBx:structure_solution>
<PDBx:structure_refinement>SHELXL93 (Sheldrick, 1993)</PDBx:structure_refinement>
<PDBx:molecular_graphics>ORTEPII (Johnson, 1976)</PDBx:molecular_graphics>
<PDBx:publication_material>PARST (Nardelli, 1983)</PDBx:publication_material>
</PDBx:computing>
</PDBx:computingCategory>
Software used in refining the cell.
Give the program or package name and a brief reference.
CAD4 (Enraf-Nonius, 1989)
Software used for data collection.
Give the program or package name and a brief reference.
CAD4 (Enraf-Nonius, 1989)
Software used for data reduction.
Give the program or package name and a brief reference.
DIFDAT, SORTRF, ADDREF (XTAL3.0, 1990)
Software used for molecular graphics.
Give the program or package name and a brief reference.
FRODO (Jones, 1986) & ORTEP (Johnson, 1965)
Program/package name for data reduction/data scaling
Program/package name for data reduction/intensity integration software
Program/package name for structure refinement method.
Software used for generating material for publication.
Give the program or package name and a brief reference.
Software used for refinement of the structure.
Give the program or package name and a brief reference.
SHELX85 (Sheldrick, 1985)
X-PLOR (Brunger, 198?)
Software used for solution of the structure.
Give the program or package name and a brief reference.
SHELX85 (Sheldrick, 1985)
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the DATABASE category have been superseded by
data items in the DATABASE_2 category. They are included
here only for compliance with older files.
The code assigned by Chemical Abstracts.
The code assigned by Cambridge Structural Database (organic and
metal-organic compounds).
The code assigned by the Inorganic Crystal Structure Data Base.
The code assigned by the Metals Data File (metal structures).
The code assigned by the NBS (NIST) Crystal Data Database
(lattice parameters).
The code assigned by the Powder Diffraction File (JCPDS/ICDD).
The ASTM CODEN designator for a journal as given in the Chemical
Source List maintained by the Chemical Astracts Service.
The journal code used in the Cambridge Structural Database.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the DATABASE_2 category record details about the
database identifiers of the data block.
These data items are assigned by database managers and should
only appear in a data block if they originate from that source.
The somewhat awkward name of this category (DATABASE_2) is a
consequence of the name DATABASE having been already used in
the CIF core, but used in a manner different from the usage
in mmCIF. Since CIF data names, once adopted, cannot be
changed, a new category was created.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:database_2Category>
<PDBx:database_2 database_id="PDB" database_code="5HVP"></PDBx:database_2>
</PDBx:database_2Category>
An abbreviation that identifies the database.
The code assigned by the database identified in
attribute database_id in category database_2.
1ABC
ABCDEF
Data items in the DATABASE_PDB_CAVEAT category record details
about features of the data block flagged as 'caveats' by the
Protein Data Bank (PDB).
These data items are included only for consistency with PDB
format files. They should appear in a data block only if that
data block was created by reformatting a PDB format file.
Example 1 - completely hypothetical
<PDBx:database_PDB_caveatCategory>
<PDBx:database_PDB_caveat id="1">
<PDBx:text>
CAVEAT 1ABC THE CRYSTAL TRANSFORMATION IS IN ERROR BUT IS</PDBx:text>
</PDBx:database_PDB_caveat>
<PDBx:database_PDB_caveat id="2">
<PDBx:text>
CAVEAT 2 1ABC UNCORRECTABLE AT THIS TIME</PDBx:text>
</PDBx:database_PDB_caveat>
</PDBx:database_PDB_caveatCategory>
The full text of the PDB caveat record.
A unique identifier for the PDB caveat record.
The DATABASE_PDB_MATRIX category provides placeholders for
transformation matrices and vectors used by the Protein Data
Bank (PDB).
These data items are included only for consistency with older
PDB format files. They should appear in a data block only if
that data block was created by reformatting a PDB format file.
The [1][1] element of the PDB ORIGX matrix.
The [1][2] element of the PDB ORIGX matrix.
The [1][3] element of the PDB ORIGX matrix.
The [2][1] element of the PDB ORIGX matrix.
The [2][2] element of the PDB ORIGX matrix.
The [2][3] element of the PDB ORIGX matrix.
The [3][1] element of the PDB ORIGX matrix.
The [3][2] element of the PDB ORIGX matrix.
The [3][3] element of the PDB ORIGX matrix.
The [1] element of the PDB ORIGX vector.
The [2] element of the PDB ORIGX vector.
The [3] element of the PDB ORIGX vector.
The [1][1] element of the PDB SCALE matrix.
The [1][2] element of the PDB SCALE matrix.
The [1][3] element of the PDB SCALE matrix.
The [2][1] element of the PDB SCALE matrix.
The [2][2] element of the PDB SCALE matrix.
The [2][3] element of the PDB SCALE matrix.
The [3][1] element of the PDB SCALE matrix.
The [3][2] element of the PDB SCALE matrix.
The [1][1] element of the PDB SCALE matrix.
The [1] element of the PDB SCALE vector.
The [2] element of the PDB SCALE vector.
The [3] element of the PDB SCALE vector.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the DATABASE_PDB_REMARK category record details
about the data block as archived by the Protein Data Bank (PDB).
Some data appearing in PDB REMARK records can be
algorithmically extracted into the appropriate data items
in the data block.
These data items are included only for consistency with older
PDB format files. They should appear in a data block only if
that data block was created by reformatting a PDB format file.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:database_PDB_remarkCategory>
<PDBx:database_PDB_remark id="3">
<PDBx:text>
REMARK 3 5HVP
REMARK 3 REFINEMENT. BY THE RESTRAINED LEAST-SQUARES PROCEDURE OF J. 5HVP
REMARK 3 KONNERT AND W. HENDRICKSON (PROGRAM *PROLSQ*). THE R 5HVP
REMARK 3 VALUE IS 0.176 FOR 12901 REFLECTIONS IN THE RESOLUTION 5HVP
REMARK 3 RANGE 8.0 TO 2.0 ANGSTROMS WITH I .GT. SIGMA(I). 5HVP
REMARK 3 5HVP
REMARK 3 RMS DEVIATIONS FROM IDEAL VALUES (THE VALUES OF 5HVP
REMARK 3 SIGMA, IN PARENTHESES, ARE THE INPUT ESTIMATED 5HVP
REMARK 3 STANDARD DEVIATIONS THAT DETERMINE THE RELATIVE 5HVP
REMARK 3 WEIGHTS OF THE CORRESPONDING RESTRAINTS) 5HVP
REMARK 3 DISTANCE RESTRAINTS (ANGSTROMS) 5HVP
REMARK 3 BOND DISTANCE 0.018(0.020) 5HVP
REMARK 3 ANGLE DISTANCE 0.038(0.030) 5HVP
REMARK 3 PLANAR 1-4 DISTANCE 0.043(0.040) 5HVP
REMARK 3 PLANE RESTRAINT (ANGSTROMS) 0.015(0.020) 5HVP
REMARK 3 CHIRAL-CENTER RESTRAINT (ANGSTROMS**3) 0.177(0.150) 5HVP
REMARK 3 NON-BONDED CONTACT RESTRAINTS (ANGSTROMS) 5HVP
REMARK 3 SINGLE TORSION CONTACT 0.216(0.500) 5HVP
REMARK 3 MULTIPLE TORSION CONTACT 0.207(0.500) 5HVP
REMARK 3 POSSIBLE HYDROGEN BOND 0.245(0.500) 5HVP
REMARK 3 CONFORMATIONAL TORSION ANGLE RESTRAINT (DEGREES) 5HVP
REMARK 3 PLANAR (OMEGA) 2.6(3.0) 5HVP
REMARK 3 STAGGERED 17.4(15.0) 5HVP
REMARK 3 ORTHONORMAL 18.1(20.0) 5HVP</PDBx:text>
</PDBx:database_PDB_remark>
<PDBx:database_PDB_remark id="4">
<PDBx:text>
REMARK 4 5HVP
REMARK 4 THE TWO CHAINS OF THE DIMERIC ENZYME HAS BEEN ASSIGNED THE 5HVP
REMARK 4 THE CHAIN INDICATORS *A* AND *B*. 5HVP</PDBx:text>
</PDBx:database_PDB_remark>
</PDBx:database_PDB_remarkCategory>
The full text of the PDB remark record.
A unique identifier for the PDB remark record.
Data items in the DATABASE_PDB_REV category record details
about the history of the data block as archived by the Protein
Data Bank (PDB).
These data items are assigned by the PDB database managers and
should only appear in a data block if they originate from that
source.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:database_PDB_revCategory>
<PDBx:database_PDB_rev num="1">
<PDBx:author_name>Fitzgerald, Paula M.D</PDBx:author_name>
<PDBx:date>1991-10-15</PDBx:date>
<PDBx:date_original>1990-04-30</PDBx:date_original>
<PDBx:status>full release</PDBx:status>
<PDBx:mod_type>0</PDBx:mod_type>
</PDBx:database_PDB_rev>
</PDBx:database_PDB_revCategory>
The name of the person responsible for submitting this revision
to the PDB.
The family name(s) followed by a comma, precedes the first
name(s) or initial(s).
Bleary, Percival R.
O'Neil, F.K.
Van den Bossche, G.
Yang, D.-L.
Simonov, Yu.A
Date the PDB revision took place. Taken from the REVDAT record.
Date the entry first entered the PDB database in the form:
yyyy-mm-dd. Taken from the PDB HEADER record.
1980-08-21
Taken from the REVDAT record. Refer to the Protein Data Bank
format description for details.
The PDB code for a subsequent PDB entry that replaced the
PDB file corresponding to this data block.
The PDB code for a previous PDB entry that was replaced by
the PDB file corresponding to this data block.
The status of this revision.
The value of attribute num in category database_PDB_rev must uniquely and
sequentially identify a record in the DATABASE_PDB_REV list.
Note that this item must be a number, and that modification
numbers are assigned in increasing numerical order.
Data items in the DATABASE_PDB_REV_RECORD category record
details about specific record types that were changed in a
given revision of a PDB entry.
These data items are assigned by the PDB database managers and
should only appear in a data block if they originate from that
source.
Example 1 - example is completely hypothetical
<PDBx:database_PDB_rev_recordCategory>
<PDBx:database_PDB_rev_record rev_num="1" type="CONECT">
<PDBx:details>Error fix - incorrect connection between atoms 2312 and 2317</PDBx:details>
</PDBx:database_PDB_rev_record>
<PDBx:database_PDB_rev_record rev_num="2" type="MATRIX">
<PDBx:details>For consistency with 1995-08-04 style-guide</PDBx:details>
</PDBx:database_PDB_rev_record>
<PDBx:database_PDB_rev_record rev_num="3" type="ORIGX">
<PDBx:details>Based on new data from author</PDBx:details>
</PDBx:database_PDB_rev_record>
</PDBx:database_PDB_rev_recordCategory>
A description of special aspects of the revision of records in
this PDB entry.
Based on new data from author
For consistency with 1995-08-04 style-guide
For consistency with structural class
This data item is a pointer to attribute num in category database_PDB_rev in the
DATABASE_PDB_REV category.
The types of records that were changed in this revision to a
PDB entry.
CRYST1
SCALE
MTRIX
ATOM
HETATM
The DATABASE_PDB_TVECT category provides placeholders for
the TVECT matrices and vectors used by the Protein Data
Bank (PDB).
These data items are included only for consistency with older
PDB format files. They should appear in a data block only if
that data block was created by reformatting a PDB format file.
A description of special aspects of this TVECT.
The [1] element of the PDB TVECT vector.
The [2] element of the PDB TVECT vector.
The [3] element of the PDB TVECT vector.
The value of attribute id in category database_PDB_tvect must uniquely identify a
record in the DATABASE_PDB_TVECT list.
Note that this item need not be a number; it can be any unique
identifier.
Data items in the DIFFRN category record details about the
diffraction data and its measurement.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:diffrnCategory>
<PDBx:diffrn id="Set1">
<PDBx:ambient_temp>293(3)</PDBx:ambient_temp>
<PDBx:ambient_environment> Mother liquor from the reservoir of the vapor diffusion experiment, mounted in room air</PDBx:ambient_environment>
<PDBx:crystal_support> 0.7 mm glass capillary, sealed with dental wax</PDBx:crystal_support>
<PDBx:crystal_treatment> Equilibrated in rotating anode radiation enclosure for 18 hours prior
to beginning of data collection.</PDBx:crystal_treatment>
</PDBx:diffrn>
</PDBx:diffrnCategory>
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer [(1991).
Acta Cryst. C47, 2276-2277].
<PDBx:diffrnCategory>
<PDBx:diffrn id="d1">
<PDBx:details>
\q scan width (1.0 + 0.14tan\q)\%, \q scan rate 1.2\% per min.
Background counts for 5 sec on each side every scan.</PDBx:details>
<PDBx:ambient_temp>293</PDBx:ambient_temp>
</PDBx:diffrn>
</PDBx:diffrnCategory>
The gas or liquid surrounding the sample, if not air.
The mean pressure in kilopascals at which the intensities were
measured.
The estimated standard deviation of attribute ambient_pressure in category diffrn.
The mean temperature in kelvins at which the intensities were
measured.
A description of special aspects of temperature control during
data collection.
The estimated standard deviation of attribute ambient_temp in category diffrn.
This data item is a pointer to attribute id in category exptl_crystal in the
EXPTL_CRYSTAL category.
The physical device used to support the crystal during data
collection.
glass capillary
quartz capillary
fiber
metal loop
Remarks about how the crystal was treated prior to intensity
measurement. Particularly relevant when intensities were
measured at low temperature.
equilibrated in hutch for 24 hours
flash frozen in liquid nitrogen
slow cooled with direct air stream
Special details of the diffraction measurement process. Should
include information about source instability, crystal motion,
degradation and so on.
This data item uniquely identifies a set of diffraction
data.
Data items in the DIFFRN_ATTENUATOR category record details
about the diffraction attenuator scales employed.
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer [(1991).
Acta Cryst. C47, 2276-2277].
<PDBx:diffrn_attenuatorCategory>
<PDBx:diffrn_attenuator code="1">
<PDBx:scale>16.976</PDBx:scale>
</PDBx:diffrn_attenuator>
</PDBx:diffrn_attenuatorCategory>
The scale factor applied when an intensity measurement is
reduced by an attenuator identified by attribute
in category diffrn_attenuator_code This scale must be multiplied by the measured intensity to
convert it to the same scale as unattenuated intensities.
A code associated with a particular attenuator setting. This
code is referenced by the attribute attenuator_code in category diffrn_refln which is
stored with the diffraction data. See attribute scale in category diffrn_attenuator.
Data items in the DIFFRN_DETECTOR category describe the
detector used to measure the scattered radiation, including
any analyser and post-sample collimation.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:diffrn_detectorCategory>
<PDBx:diffrn_detector diffrn_id="d1">
<PDBx:detector>multiwire</PDBx:detector>
<PDBx:type>Siemens</PDBx:type>
</PDBx:diffrn_detector>
</PDBx:diffrn_detectorCategory>
A description of special aspects of the radiation detector.
Need new example here.
The general class of the radiation detector.
photographic film
scintillation counter
CCD plate
BF~3~ counter
The deadtime in microseconds of the detectors used to measure
the diffraction intensities.
The date of data collection.
1996-12-25
The make, model or name of the detector device used.
This data item is a pointer to attribute id in category diffrn in the DIFFRN
category.
Data items in the DIFFRN_MEASUREMENT category record details
about the device used to orient and/or position the crystal
during data measurement and the manner in which the diffraction
data were measured.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:diffrn_measurementCategory>
<PDBx:diffrn_measurement diffrn_id="d1">
<PDBx:device>3-circle camera</PDBx:device>
<PDBx:device_type>Supper model x</PDBx:device_type>
<PDBx:device_details>none</PDBx:device_details>
<PDBx:method>omega scan</PDBx:method>
<PDBx:details> 440 frames, 0.20 degrees, 150 sec, detector distance 12 cm, detector
angle 22.5 degrees</PDBx:details>
</PDBx:diffrn_measurement>
</PDBx:diffrn_measurementCategory>
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer [(1991).
Acta Cryst. C47, 2276-2277].
<PDBx:diffrn_measurementCategory>
<PDBx:diffrn_measurement diffrn_id="s1">
<PDBx:device_type>Philips PW1100/20 diffractometer</PDBx:device_type>
<PDBx:method>\q/2\q</PDBx:method>
</PDBx:diffrn_measurement>
</PDBx:diffrn_measurementCategory>
A description of special aspects of the intensity measurement.
440 frames, 0.20 degrees, 150 sec, detector
distance 12 cm, detector angle 22.5 degrees
The general class of goniometer or device used to support and
orient the specimen.
3-circle camera
4-circle camera
kappa-geometry camera
oscillation camera
precession camera
A description of special aspects of the device used to measure
the diffraction intensities.
Need new example here.
The make, model or name of the measurement device
(goniometer) used.
Supper model q
Huber model r
Enraf-Nonius model s
homemade
Method used to measure intensities.
profile data from theta/2theta scans
The physical device used to support the crystal during data
collection.
glass capillary
quartz capillary
fiber
metal loop
This data item is a pointer to attribute id in category diffrn in the DIFFRN
category.
Data items in the DIFFRN_ORIENT_MATRIX category record details
about the orientation matrix used in data measurement.
Example 1 - based on CAD-4 diffractometer data obtained for
Yb(S-C5H4N)2 (THF)4
<PDBx:diffrn_orient_matrixCategory>
<PDBx:diffrn_orient_matrix diffrn_id="set1">
<PDBx:type>
reciprocal axis matrix, multiplies hkl vector to generate
diffractometer xyz vector and diffractometer angles</PDBx:type>
<PDBx:UB11>-0.071479</PDBx:UB11>
<PDBx:UB12>0.020208</PDBx:UB12>
<PDBx:UB13>0.039076</PDBx:UB13>
<PDBx:UB21>0.035372</PDBx:UB21>
<PDBx:UB22>0.056209</PDBx:UB22>
<PDBx:UB23>0.078324</PDBx:UB23>
<PDBx:UB31>-0.007470</PDBx:UB31>
<PDBx:UB32>0.067854</PDBx:UB32>
<PDBx:UB33>-0.017832</PDBx:UB33>
</PDBx:diffrn_orient_matrix>
</PDBx:diffrn_orient_matrixCategory>
The [1][1] element of the 3x3 matrix that defines the dimensions
of the reciprocal cell and its orientation to the local
diffractometer axes. See also attribute type in category diffrn_orient_matrix.
The [1][2] element of the 3x3 matrix that defines the dimensions
of the reciprocal cell and its orientation to the local
diffractometer axes. See also attribute type in category diffrn_orient_matrix.
The [1][3] element of the 3x3 matrix that defines the dimensions
of the reciprocal cell and its orientation to the local
diffractometer axes. See also attribute type in category diffrn_orient_matrix.
The [2][1] element of the 3x3 matrix that defines the dimensions
of the reciprocal cell and its orientation to the local
diffractometer axes. See also attribute type in category diffrn_orient_matrix.
The [2][2] element of the 3x3 matrix that defines the dimensions
of the reciprocal cell and its orientation to the local
diffractometer axes. See also attribute type in category diffrn_orient_matrix.
The [2][3] element of the 3x3 matrix that defines the dimensions
of the reciprocal cell and its orientation to the local
diffractometer axes. See also attribute type in category diffrn_orient_matrix.
The [3][1] element of the 3x3 matrix that defines the dimensions
of the reciprocal cell and its orientation to the local
diffractometer axes. See also attribute type in category diffrn_orient_matrix.
The [3][2] element of the 3x3 matrix that defines the dimensions
of the reciprocal cell and its orientation to the local
diffractometer axes. See also attribute type in category diffrn_orient_matrix.
The [3][3] element of the 3x3 matrix that defines the dimensions
of the reciprocal cell and its orientation to the local
diffractometer axes. See also attribute type in category diffrn_orient_matrix.
A description of the orientation matrix type and how it should
be applied to define the orientation of the crystal precisely
with respect to the diffractometer axes.
This data item is a pointer to attribute id in category diffrn in the DIFFRN
category.
Data items in the DIFFRN_ORIENT_REFLN category record details
about the reflections that define the orientation matrix used in
measurement of diffraction intensities.
Example 1 - based on CAD-4 diffractometer data obtained for
Yb(S-C5H4N)2 (THF)4
<PDBx:diffrn_orient_reflnCategory>
<PDBx:diffrn_orient_refln diffrn_id="myset1" index_h="2" index_k="0" index_l="2">
<PDBx:angle_chi>-28.45</PDBx:angle_chi>
<PDBx:angle_kappa>-11.32</PDBx:angle_kappa>
<PDBx:angle_omega>5.33</PDBx:angle_omega>
<PDBx:angle_phi>101.78</PDBx:angle_phi>
<PDBx:angle_psi>0.00</PDBx:angle_psi>
<PDBx:angle_theta>10.66</PDBx:angle_theta>
</PDBx:diffrn_orient_refln>
</PDBx:diffrn_orient_reflnCategory>
Diffractometer angle chi in degrees of a reflection used to
define the orientation matrix. See attribute UB in category diffrn_orient_matrix and
the Miller indices in the DIFFRN_ORIENT_REFLN category.
Diffractometer angle kappa in degrees of a reflection used to
define the orientation matrix. See attribute UB in category diffrn_orient_matrix and
the Miller indices in the DIFFRN_ORIENT_REFLN category.
Diffractometer angle omega in degrees of a reflection used to
define the orientation matrix. See attribute UB in category diffrn_orient_matrix and
the Miller indices in the DIFFRN_ORIENT_REFLN category.
Diffractometer angle phi in degrees of a reflection used to
define the orientation matrix. See attribute UB in category diffrn_orient_matrix and
the Miller indices in the DIFFRN_ORIENT_REFLN category.
Diffractometer angle psi in degrees of a reflection used to
define the orientation matrix. See attribute UB in category diffrn_orient_matrix and
the Miller indices in the DIFFRN_ORIENT_REFLN category.
Diffractometer angle theta in degrees of a reflection used to
define the orientation matrix. See attribute UB in category diffrn_orient_matrix and
the Miller indices in the DIFFRN_ORIENT_REFLN category.
This data item is a pointer to attribute id in category diffrn in the DIFFRN
category.
Miller index h of a reflection used to define the orientation
matrix.
Miller index k of a reflection used to define the orientation
matrix.
Miller index l of a reflection used to define the orientation
matrix.
Data items in the DIFFRN_RADIATION category describe
the radiation used in measuring diffraction intensities,
its collimation and monochromatisation before the sample.
Post-sample treatment of the beam is described by data
items in the DIFFRN_DETECTOR category.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:diffrn_radiationCategory>
<PDBx:diffrn_radiation diffrn_id="set1">
<PDBx:collimation>0.3 mm double pinhole</PDBx:collimation>
<PDBx:monochromator>graphite</PDBx:monochromator>
<PDBx:type>Cu K\a</PDBx:type>
<PDBx:wavelength_id>1</PDBx:wavelength_id>
</PDBx:diffrn_radiation>
</PDBx:diffrn_radiationCategory>
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer [(1991).
Acta Cryst. C47, 2276-2277].
<PDBx:diffrn_radiationCategory>
<PDBx:diffrn_radiation>
<PDBx:wavelength_id>1</PDBx:wavelength_id>
<PDBx:type>Cu K\a</PDBx:type>
<PDBx:monochromator>graphite</PDBx:monochromator>
</PDBx:diffrn_radiation>
</PDBx:diffrn_radiationCategory>
The collimation or focusing applied to the radiation.
0.3 mm double-pinhole
0.5 mm
focusing mirrors
Absorption edge in angstroms of the radiation filter used.
Half-width in millimetres of the incident beam in the
direction perpendicular to the diffraction plane.
The method used to obtain monochromatic radiation. If a mono-
chromator crystal is used the material and the indices of the
Bragg reflection are specified.
Zr filter
Ge 220
none
equatorial mounted graphite
SINGLE WAVELENGTH, LAUE, or MAD.
SINGLE WAVELENGTH
MONOCHROMATIC
LAUE
MAD
OTHER
Monochromatic or Laue.
M
L
Wavelength of radiation.
Comma separated list of wavelengths or wavelength range.
The angle in degrees, as viewed from the specimen, between the
perpendicular component of the polarisation and the diffraction
plane. See attribute in category diffrn_radiation_polarisn_ratio.
Polarisation ratio of the diffraction beam incident on the
crystal. It is the ratio of the perpendicularly polarised to the
parallel polarised component of the radiation. The perpendicular
component forms an angle of attribute polarisn_norm in category diffrn_radiation to
the normal to the diffraction plane of the sample (i.e. the plane
containing the incident and reflected beams).
Name of the type of radiation used. It is strongly encouraged
that this field be specified so that the probe radiation
can be simply determined.
The nature of the radiation. This is typically a description
of the X-ray wavelength in Siegbahn notation.
CuK\a
Cu K\a~1~
Cu K-L~2,3~
white-beam
This data item is a pointer to attribute id
in category diffrn_radiation_wavelength in the DIFFRN_RADIATION_WAVELENGTH category.
The IUPAC symbol for the X-ray wavelength for probe radiation.
This data item is a pointer to attribute id in category diffrn in the DIFFRN
category.
Data items in the DIFFRN_RADIATION_WAVELENGTH category
describe the wavelength of radiation used in measuring
diffraction intensities. Items may be looped to identify
and assign weights to distinct components of a
polychromatic beam.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:diffrn_radiation_wavelengthCategory>
<PDBx:diffrn_radiation_wavelength id="1">
<PDBx:wavelength>1.54</PDBx:wavelength>
<PDBx:wt>1.0</PDBx:wt>
</PDBx:diffrn_radiation_wavelength>
</PDBx:diffrn_radiation_wavelengthCategory>
The radiation wavelength in angstroms.
The relative weight of a wavelength identified by the code
attribute id in category diffrn_radiation_wavelength in the list of wavelengths.
The code identifying each value of attribute
in category diffrn_radiation_wavelength Items in the DIFFRN_RADIATION_WAVELENGTH category are looped
when multiple wavelengths are used.
This code is used to link with the DIFFRN_REFLN category.
The attribute wavelength_id in category diffrn_refln codes must match one of
the codes defined in this category.
x1
x2
neut
Data items in the DIFFRN_REFLN category record details about
the intensities measured in the diffraction data set
identified by attribute diffrn_id.
in category diffrn_refln
The DIFFRN_REFLN data items refer to individual intensity
measurements, and must be included in looped lists.
The DIFFRN_REFLNS data items specify the parameters that apply
to all intensity measurements in the particular diffraction
data set identified by attribute diffrn_id in category diffrn_reflns.
Example 1 - based on CAD-4 diffractometer data obtained for
Yb(S-C5H4N)2 (THF)4 for data set 'set1' reflection 1102
<PDBx:diffrn_reflnCategory>
<PDBx:diffrn_refln diffrn_id="set1" id="1102">
<PDBx:wavelength_id>Cu1fixed</PDBx:wavelength_id>
<PDBx:angle_chi>32.21</PDBx:angle_chi>
<PDBx:angle_kappa>20.12</PDBx:angle_kappa>
<PDBx:angle_omega>11.54</PDBx:angle_omega>
<PDBx:angle_phi>176.02</PDBx:angle_phi>
<PDBx:angle_psi>0.00</PDBx:angle_psi>
<PDBx:angle_theta>23.08</PDBx:angle_theta>
<PDBx:attenuator_code>Ni.005</PDBx:attenuator_code>
<PDBx:counts_bg_1>22</PDBx:counts_bg_1>
<PDBx:counts_bg_2>25</PDBx:counts_bg_2>
<PDBx:counts_net>3450</PDBx:counts_net>
<PDBx:counts_peak>321</PDBx:counts_peak>
<PDBx:counts_total>3499</PDBx:counts_total>
<PDBx:detect_slit_horiz>0.04</PDBx:detect_slit_horiz>
<PDBx:detect_slit_vert>0.02</PDBx:detect_slit_vert>
<PDBx:elapsed_time>1.00</PDBx:elapsed_time>
<PDBx:index_h>4</PDBx:index_h>
<PDBx:index_k>0</PDBx:index_k>
<PDBx:index_l>2</PDBx:index_l>
<PDBx:intensity_net>202.56</PDBx:intensity_net>
<PDBx:intensity_sigma>2.18</PDBx:intensity_sigma>
<PDBx:scale_group_code>A24</PDBx:scale_group_code>
<PDBx:scan_mode>om</PDBx:scan_mode>
<PDBx:scan_mode_backgd>mo</PDBx:scan_mode_backgd>
<PDBx:scan_rate>1.2</PDBx:scan_rate>
<PDBx:scan_time_backgd>900.00</PDBx:scan_time_backgd>
<PDBx:scan_width>1.0</PDBx:scan_width>
<PDBx:sint_over_lambda>0.25426</PDBx:sint_over_lambda>
<PDBx:standard_code>1</PDBx:standard_code>
<PDBx:wavelength>1.54184</PDBx:wavelength>
</PDBx:diffrn_refln>
</PDBx:diffrn_reflnCategory>
The diffractometer angle chi in degrees of a reflection. This
angle corresponds to the specified orientation matrix
and the original measured cell before any subsequent cell
transformations.
The diffractometer angle kappa in degrees of a reflection. This
angle corresponds to the specified orientation matrix
and the original measured cell before any subsequent cell
transformations.
The diffractometer angle omega in degrees of a reflection. This
angle corresponds to the specified orientation matrix
and the original measured cell before any subsequent cell
transformations.
The diffractometer angle phi in degrees of a reflection. This
angle corresponds to the specified orientation matrix
and the original measured cell before any subsequent cell
transformations.
The diffractometer angle psi in degrees of a reflection. This
angle corresponds to the specified orientation matrix
and the original measured cell before any subsequent cell
transformations.
The diffractometer angle theta in degrees of a reflection. This
angle corresponds to the specified orientation matrix
and the original measured cell before any subsequent cell
transformations.
The code identifying the attenuator setting for this reflection.
This code must match one of the attribute code in category diffrn_attenuator values.
The diffractometer counts for the measurement of the background
before the peak.
The diffractometer counts for the measurement of the background
after the peak.
The diffractometer counts for the measurement of net counts after
background removal.
The diffractometer counts for the measurement of counts for the
peak scan or position.
The diffractometer counts for the measurement of total counts
(background plus peak).
Total slit aperture in degrees in the diffraction plane.
Total slit aperture in degrees perpendicular to the
diffraction plane.
Elapsed time in minutes from the start of diffraction measurement
to the measurement of this intensity.
Miller index h of a diffraction reflection. The values of
the Miller indices in the DIFFRN_REFLN category need not match
the values of the Miller indices in the REFLN category if a
transformation of the original measured cell has taken place.
Details of the cell transformation are described in
attribute reduction_process in category diffrn_reflns. See also
attribute transf_matrix in category diffrn_reflns.
Miller index k of a diffraction reflection. The values of
the Miller indices in the DIFFRN_REFLN category need not match
the values of the Miller indices in the REFLN category if a
transformation of the original measured cell has taken place.
Details of the cell transformation are described in
attribute reduction_process in category diffrn_reflns. See also
attribute transf_matrix in category diffrn_reflns.
Miller index l of a diffraction reflection. The values of
the Miller indices in the DIFFRN_REFLN category need not match
the values of the Miller indices in the REFLN category if a
transformation of the original measured cell has taken place.
Details of the cell transformation are described in
attribute reduction_process in category diffrn_reflns. See also
attribute transf_matrix in category diffrn_reflns.
Net intensity calculated from the diffraction counts after the
attenuator and standard scales have been applied.
Standard uncertainty (e.s.d.) of the intensity calculated from
the diffraction counts after the attenuator and standard scales
have been applied.
The code identifying the scale applying to this reflection.
This data item is a pointer to attribute code in category diffrn_scale_group in the
DIFFRN_SCALE_GROUP category.
The code identifying the mode of scanning with a diffractometer.
See _diffrn_refln.scan_width and _diffrn_refln.scan_mode_backgd.
The code identifying the mode of scanning a reflection to
measure the background intensity.
The rate of scanning a reflection to measure the intensity in
degrees per minute.
The time spent measuring each background in seconds.
The scan width in degrees of the scan mode defined by the code
attribute scan_mode in category diffrn_refln.
The (sin theta)/lambda value in reciprocal angstroms for this
reflection.
The code identifying that this reflection was measured as a
standard intensity.
This data item is a pointer to attribute code in category diffrn_standard_refln in the
DIFFRN_STANDARD_REFLN category.
The mean wavelength in angstroms of radiation used to measure
the intensity of this reflection. This is an important parameter
for data collected using energy dispersive detectors or the
Laue method.
This data item is a pointer to attribute wavelength_id in category diffrn_radiation in
the DIFFRN_RADIATION category.
This data item is a pointer to attribute id in category diffrn in the DIFFRN
category.
The value of diffrn_refln.id must uniquely identify the
reflection in the data set identified by the item
attribute diffrn_id.
in category diffrn_refln
Note that this item need not be a number; it can be any unique
identifier.
Data items in the DIFFRN_REFLNS category record details about
the set of intensities measured in the diffraction experiment.
The DIFFRN_REFLN data items refer to individual intensity
measurements, and must be included in looped lists.
The DIFFRN_REFLNS data items specify the parameters that apply
to all intensity measurements in a diffraction data set.
The residual [sum|avdel(I)| / sum|av(I)|] for symmetry-equivalent
reflections used to calculate the average intensity av(I). The
avdel(I) term is the average difference between av(I) and the
individual symmetry-equivalent intensities.
Measure [sum|sigma(I)|/sum|net(I)|] for all measured reflections.
The maximum value of the diffraction reflection data specified
by attribute index_h in category diffrn_refln.
The minimum value of the diffraction reflection data specified
by attribute index_h in category diffrn_refln.
The maximum value of the diffraction reflection data specified
by attribute index_k in category diffrn_refln.
The minimum value of the diffraction reflection data specified
by attribute index_k in category diffrn_refln.
The maximum value of the diffraction reflection data specified
by attribute index_l in category diffrn_refln.
The minimum value of the diffraction reflection data specified
by attribute index_l in category diffrn_refln.
The total number of measured intensities, excluding reflections
that are classified as systematically absent.
A description of the process used to reduce the intensity data
into structure-factor magnitudes.
data averaged using Fisher test
Maximum theta angle in degrees for the measured diffraction
intensities.
Minimum theta angle in degrees for the measured diffraction
intensities.
The [1][1] element of the 3x3 matrix used to transform Miller
indices in the DIFFRN_REFLN category into the Miller indices in
the REFLN category.
The [1][2] element of the 3x3 matrix used to transform Miller
indices in the DIFFRN_REFLN category into the Miller indices in
the REFLN category.
The [1][3] element of the 3x3 matrix used to transform Miller
indices in the DIFFRN_REFLN category into the Miller indices in
the REFLN category.
The [2][1] element of the 3x3 matrix used to transform Miller
indices in the DIFFRN_REFLN category into the Miller indices in
the REFLN category.
The [2][2] element of the 3x3 matrix used to transform Miller
indices in the DIFFRN_REFLN category into the Miller indices in
the REFLN category.
The [2][3] element of the 3x3 matrix used to transform Miller
indices in the DIFFRN_REFLN category into the Miller indices in
the REFLN category.
The [3][1] element of the 3x3 matrix used to transform Miller
indices in the DIFFRN_REFLN category into the Miller indices in
the REFLN category.
The [3][2] element of the 3x3 matrix used to transform Miller
indices in the DIFFRN_REFLN category into the Miller indices in
the REFLN category.
The [3][3] element of the 3x3 matrix used to transform Miller
indices in the DIFFRN_REFLN category into the Miller indices in
the REFLN category.
This data item is a pointer to attribute id in category diffrn in the DIFFRN
category.
Data items in the DIFFRN_SCALE_GROUP category record details
about the reflections used to scale the diffraction intensities.
Scaling groups might, for instance, correspond to each film in a
multi-film data set, or each crystal in a multi-crystal data set.
Example 1 - based on CAD-4 diffractometer data obtained for
Yb(S-C5H4N)2 (THF)4
<PDBx:diffrn_scale_groupCategory>
<PDBx:diffrn_scale_group code="A24">
<PDBx:I_net>1.021</PDBx:I_net>
</PDBx:diffrn_scale_group>
</PDBx:diffrn_scale_groupCategory>
The scale for a specific measurement group which is to be
multiplied with the net intensity to place all intensities
in the DIFFRN_REFLN or REFLN list on a common scale.
The value of diffrn_scale_group.code must uniquely identify a
record in the DIFFRN_SCALE_GROUP list.
Note that this item need not be a number; it can be any unique
identifier.
1
2
c1
c2
Data items in the DIFFRN_SOURCE category record details of
the source of radiation used in the diffraction experiment.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:diffrn_sourceCategory>
<PDBx:diffrn_source diffrn_id="s1">
<PDBx:source>rotating anode</PDBx:source>
<PDBx:type>Rigaku RU-200</PDBx:type>
<PDBx:power>50kw,180mA</PDBx:power>
<PDBx:target>8mm x 0.4 mm broad-focus</PDBx:target>
</PDBx:diffrn_source>
</PDBx:diffrn_sourceCategory>
The current in milliamperes at which the radiation source
was operated.
A description of special aspects of the radiation source used.
Synchrotron beamline.
Synchrotron site.
The power in kilowatts at which the radiation source
was operated.
The dimensions of the source as viewed from the sample.
8mm x 0.4 mm fine-focus
broad focus
The general class of the radiation source.
sealed X-ray tube
nuclear reactor
spallation source
electron microscope
rotating-anode X-ray tube
synchrotron
The chemical element symbol for the X-ray target
(usually the anode) used for generation of X-rays.
This can be used also for spallation sources.
The make, model or name of the source of radiation.
NSLS beamline X8C
Rigaku RU200
The voltage in kilovolts at which the radiation source was
operated.
This data item is a pointer to attribute id in category diffrn in the DIFFRN
category.
Data items in the DIFFRN_STANDARD_REFLN category record details
about the reflections treated as standards during the measurement
of a set of diffraction intensities.
Note that these are the individual standard reflections, not the
results of the analysis of the standard reflections.
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer [(1991).
Acta Cryst. C47, 2276-2277].
<PDBx:diffrn_standard_reflnCategory>
<PDBx:diffrn_standard_refln diffrn_id="s1" code="1">
<PDBx:index_h>3</PDBx:index_h>
<PDBx:index_k>2</PDBx:index_k>
<PDBx:index_l>4</PDBx:index_l>
</PDBx:diffrn_standard_refln>
<PDBx:diffrn_standard_refln diffrn_id="s1" code="1">
<PDBx:index_h>1</PDBx:index_h>
<PDBx:index_k>9</PDBx:index_k>
<PDBx:index_l>1</PDBx:index_l>
</PDBx:diffrn_standard_refln>
<PDBx:diffrn_standard_refln diffrn_id="s1" code="1">
<PDBx:index_h>3</PDBx:index_h>
<PDBx:index_k>0</PDBx:index_k>
<PDBx:index_l>10</PDBx:index_l>
</PDBx:diffrn_standard_refln>
</PDBx:diffrn_standard_reflnCategory>
Miller index h of a standard reflection used in the diffraction
measurement process.
Miller index k of a standard reflection used in the diffraction
measurement process.
Miller index l of a standard reflection used in the diffraction
measurement process.
This data item is a pointer to attribute id in category diffrn in the DIFFRN
category.
The code identifying a reflection measured as a standard
reflection with the indices attribute index_h,
in category diffrn_standard_refln attribute index_k in category diffrn_standard_refln and
attribute index_l in category diffrn_standard_refln. This is the same code as the
attribute standard_code in category diffrn_refln in the DIFFRN_REFLN list.
1
2
c1
c2
Data items in the DIFFRN_STANDARDS category record details
about the set of standard reflections used to monitor intensity
stability during measurement of diffraction intensities.
Note that these records describe properties common to the set of
standard reflections, not the standard reflections themselves.
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer [(1991).
Acta Cryst. C47, 2276-2277].
<PDBx:diffrn_standardsCategory>
<PDBx:diffrn_standards diffrn_id="s1">
<PDBx:number>3</PDBx:number>
<PDBx:interval_time>120</PDBx:interval_time>
<PDBx:decay_>0</PDBx:decay_>
</PDBx:diffrn_standards>
</PDBx:diffrn_standardsCategory>
The percentage decrease in the mean of the intensities
for the set of standard reflections at the start of the
measurement process and at the finish. This value usually
affords a measure of the overall decay in crystal quality
during the diffraction measurement process. Negative values
are used in exceptional instances where the final intensities
are greater than the initial ones.
The number of reflection intensities between the measurement of
standard reflection intensities.
The time in minutes between the measurement of standard
reflection intensities.
The number of unique standard reflections used in the diffraction
measurements.
The standard uncertainty (e.s.d.) of the individual mean
standard scales applied to the intensity data.
This data item is a pointer to attribute id in category diffrn in the DIFFRN
category.
Data items in the EM_2D_CRYSTAL_GROW category
record details of growth conditions for 2d crystal samples.
Example 1 - based on PDB entry 1AT9 and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_2d_crystal_growCategory>
<PDBx:em_2d_crystal_grow id="1">
<PDBx:atmosphere>room air</PDBx:atmosphere>
<PDBx:pH>5.2</PDBx:pH>
<PDBx:temp>18</PDBx:temp>
<PDBx:buffer_id>2</PDBx:buffer_id>
<PDBx:details>on grid</PDBx:details>
<PDBx:number_2d_crystals>129</PDBx:number_2d_crystals>
<PDBx:citation_id>2</PDBx:citation_id>
</PDBx:em_2d_crystal_grow>
</PDBx:em_2d_crystal_growCategory>
The type of the apparatus used for growing the crystals.
Langmuir trough
The type of atmosphere in which crystals were grown.
room air
This data item is a pointer to attribute id in category em_buffer in the
BUFFER category.
This data item is a pointer to attribute id
in category citation in the CITATION category.
Any additional items concerning 2d crystal growth.
The approximate size (microns squared) of 2d crystals imaged.
The method used for growing the crystals.
lipid monolayer
The number of 2d crystals imaged.
the pH value used for growing the crystals.
4.7
The value of the temperature in degrees Kelvin used for
growing the crystals.
293
The length of time required to grow the crystals.
approximately 2 days
The value of attribute crystal_id
in category em_2d_crystal_grow must uniquely identify the sample 2d crystal.
Data items in the EM_2D_PROJECTION_SELECTION category
record details of images from scanned micrographs and the
number of particles selected from a scanned set of micrographs.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_2d_projection_selectionCategory>
<PDBx:em_2d_projection_selection entry_id="1">
<PDBx:software_name>1</PDBx:software_name>
<PDBx:method>INTERACTIVE</PDBx:method>
<PDBx:citation_id>1</PDBx:citation_id>
</PDBx:em_2d_projection_selection>
</PDBx:em_2d_projection_selectionCategory>
This data item is a pointer to attribute id in category citation in the
CITATION category.
Any additional details used for selecting observed assemblies.
negative monitor contrast facilitated particle picking
The method used for selecting observed assemblies.
particles picked interactively from monitor
The number of particles selected from the projection set of images.
840
This data item is a pointer to attribute name in category software in the
SOFTWARE category.
The value of attribute entry_id in category em_2d_projection_selection points to
the ENTRY category.
Data items in the 3D_FITTING category
record details of the method of fitting atomic
coordinates from a PDB file into a 3d-em
volume map file
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_3d_fittingCategory>
<PDBx:em_3d_fitting id="1" entry_id="1DYL">
<PDBx:method>AUTOMATIC</PDBx:method>
<PDBx:target_criteria>R-FACTOR</PDBx:target_criteria>
<PDBx:software_name>1</PDBx:software_name>
<PDBx:ref_space>REAL</PDBx:ref_space>
<PDBx:ref_protocol>RIGID BODY REFINEMENT</PDBx:ref_protocol>
<PDBx:details> THE CRYSTAL STRUCTURE OF THE CAPSID
PROTEIN FROM CHOI ET AL (1997) PROTEINS 3 27:345-359
(SUBUNIT A OF PDB FILE 1VCQ) WAS PLACED INTO THE CRYO-EM
DENSITY MAP. THE CAPSID PROTEIN WAS FIRST MANUALLY POSITIONED
INTO THE CRYO-EM DENSITY CORRESPONDING TO POSITIONS OF THE
FOUR INDEPENDENT MONOMER DENSITIES BETWEEN THE INNER LEAFLET
OF THE BILAYER AND THE RNA. THESE POSITIONS WERE THEN REFINED
BY RIGID BODY REFINEMENT IN REAL SPACE WITH THE PROGRAM EMFIT
(CHENG ET AL. 1995, CELL 80, 621-630). THE QUALITY OF THE FIT
CAN BE SEEN FROM THE MAP DENSITY WITHIN THE PROTEIN. ALL 4563
ATOMS ARE IN DENSITY OF AT LEAST 4 SIGMA (96.73) ABOVE THE
AVERAGE (512.04), 1167 ATOMS ARE IN DENSITY BETWEEN 4 AND 5
SIGMA, 3174 ATOMS ARE IN DENSITY BETWEEN 5 AND 6 SIGMA, AND 222
ATOMS ARE IN DENSTY OF 6 SIGMA OR ABOVE. THE VARIATION IN
DENSITY OVER THE FITTED PROTEIN CAN BE VISUALIZED WITH THE
PSEUDO TEMPERATURE FACTOR. THE DENSITY VALUE AT EACH ATOM IS
GIVEN IN THE 8TH COLUM (USUALLY THE OCCUPANCY) AS THE NUMBER
OF STANDARD DEVIATION ABOVE BACKGROUND. COLUMN NINE (USUALLY
THE TEMPERATURE FACTOR) CONTAINS THE VALUE OF THE RELATIVE
DENSITY WITHIN THE FITTED PROTEIN SCALED LINEARLY SO THAT THE
MINIMUM DENSITY IS 100.0 AND THE MAXIMUM DENSITY IS 1.0. THE
ATOMS THAT LIE IN THE LOWER DENSITY REGIONS WILL HAVE THE
HIGHEST PSEUDO TEMPERATURE FACTORS. </PDBx:details>
</PDBx:em_3d_fitting>
</PDBx:em_3d_fittingCategory>
Any additional details regarding fitting of atomic
coordinates into the 3d-em volume.
partial
The method used to fit atomic coordinates
into the 3dem reconstructed map.
The overall B (temperature factor) value for the 3d-em volume.
The type of protocol used in the refinement.
rigid body
A flag to indicate whether fitting was carried out in real
or reciprocal refinement space.
This data item is a pointer to attribute name
in category software in the category.
The quality of fit of the atomic coordinates into the
3dem volume map.
best visual fit using the program O
The value of attribute id in category em_3d_fitting must uniquely identify
a fitting procedure of atomic coordinates
into 3dem reconstructed volume map.
This data item is a pointer to _entry_id in
the ENTRY category.
Data items in the 3D_FITTING_LIST category
lists the methods of fitting atomic coordinates from a PDB file
into a 3d-em volume map file
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_3d_fitting_listCategory>
<PDBx:em_3d_fitting_list id="1">
<PDBx:pdb_entry_id>1VCQ</PDBx:pdb_entry_id>
</PDBx:em_3d_fitting_list>
</PDBx:em_3d_fitting_listCategory>
The chain id for the entry used in fitting.
The PDB code for the entry used in fitting.
This data item is a unique identifier.
The value of attribute 3d_fitting_id in category em_3d_fitting_list is a pointer
to attribute id in category em_3d_fitting in the 3d_fitting category
Data items in the EM_3D_RECONSTRUCTION category
record details of the 3D reconstruction procedure from 2D projections.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_3d_reconstructionCategory>
<PDBx:em_3d_reconstruction entry_id="1DYL" id="1">
<PDBx:method>CROSS-COMMON LINES</PDBx:method>
<PDBx:citation_id>1</PDBx:citation_id>
<PDBx:resolution>9</PDBx:resolution>
<PDBx:nominal_pixel_size>2.64</PDBx:nominal_pixel_size>
<PDBx:actual_pixel_size>2.52</PDBx:actual_pixel_size>
</PDBx:em_3d_reconstruction>
</PDBx:em_3d_reconstructionCategory>
The actual pixel size of projection set of images.
This data item is a pointer to attribute id in category citation in the
CITATION category.
The CTF-correction method.
The Contrast Transfer Function CTF compensation for low contrast
specimens (e.g. frozen-hydrated), for which phase contrast is the only
significant mechanism, then higher defocus levels must be used to
achieve any significant transfer, and several images at different
focus levels must be combined to complete the information lost from
the transfer gaps of any one image. The CTF correction can be applied
to each extracted particle separately or to the whole micrograph after
digitisation. The simplest level of compensation is to reverse phases
at the negative lobes of the CTF.
CTF correction of each particle
Any additional details used in the 3d reconstruction.
The magnification calibration method for the 3d reconstruction.
The algorithm method used for the 3d-reconstruction.
cross-common lines
The nominal pixel size of the projection set of images.
The final resolution (in angstroms)of the 3d reconstruction.
The method used to determine the final resolution
of the 3d reconstruction.
The Fourier Shell Correlation criterion as a measure of
resolution is based on the concept of splitting the (2D)
data set into two halves; averaging each and comparing them
using the Fourier Ring Correlation (FRC) technique.
FSC at 0.5 cut-off
This data item is a pointer to attribute id in category entry in the ENTRY category.
The value of attribute id in category em_3d_reconstruction must
uniquely identify the 3d reconstruction.
Data items in the EM_ASSEMBLY category record details
about the type of complex assembly that describes the
nature of the sample studied.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_assemblyCategory>
<PDBx:em_assembly id="1" entry_id="1DYL">
<PDBx:name>virus</PDBx:name>
<PDBx:aggregation_state>ICOSAHEDRAL</PDBx:aggregation_state>
<PDBx:composition>virus</PDBx:composition>
<PDBx:num_components>1</PDBx:num_components>
</PDBx:em_assembly>
</PDBx:em_assemblyCategory>
A description of the aggregation state of the assembly.
The known composition of the assembly.
A description of any additional details
describing the observed sample.
This structure was preferentially oriented (end-on)on the grid.
The structure was monodisperse.
The value (in megadaltons) of the experimentally
determined molecular weight of the assembly.
The method used in determining
the molecular weight.
The value (in megadaltons) of the theoretically
determined molecular weight of the assembly.
The name of the assembly of observed complexes.
The number of components of the biological assembly.
The value of attribute id in category em_assembly must uniquely identify
a collection of observed complexes.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the BUFFER category
record details of the sample buffer.
Any additional details to do with buffer.
aerated
The name of the buffer.
Acetic acid
The value of attribute id in category em_buffer must
uniquely identify the sample buffer.
Constituents of buffer in sample
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_buffer_componentsCategory>
<PDBx:em_buffer_components buffer_id="1" id="1">
<PDBx:name>NaCl</PDBx:name>
<PDBx:volume>0.200 </PDBx:volume>
<PDBx:conc>4 </PDBx:conc>
</PDBx:em_buffer_components>
<PDBx:em_buffer_components buffer_id="1" id="2">
<PDBx:name>Acetic Acid</PDBx:name>
<PDBx:volume>0.047 </PDBx:volume>
<PDBx:conc>100</PDBx:conc>
</PDBx:em_buffer_components>
<PDBx:em_buffer_components buffer_id="1" id="3">
<PDBx:name>water</PDBx:name>
<PDBx:volume>0.700 </PDBx:volume>
<PDBx:conc>neat</PDBx:conc>
</PDBx:em_buffer_components>
</PDBx:em_buffer_componentsCategory>
The millimolar concentration of buffer component.
200
Any additional details to do with buffer composition.
pH adjusted with NaOH
The name of each buffer component.
Acetic acid
The volume of buffer component.
0.200
This data item is a pointer to attribute id in category em_buffer in the BUFFER category.
The value of attribute id in category em_buffer_components must
uniquely identify a component of the buffer.
Data items in the EM_DETECTOR category record details
of the image detector type.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_detectorCategory>
<PDBx:em_detector entry_id="1DYL" id="1">
<PDBx:type>KODAK SO163 FILM</PDBx:type>
</PDBx:em_detector>
</PDBx:em_detectorCategory>
Any additional information about the detection system.
The detective_quantum_efficiency (DQE)is defined as the
square of the signal-to-noise ratio in the recording device
divided by the square of the signal-to-ratio in the electron beam:
(SIGNAL/NOISE)2 recording device
DQE = -------------------------------
(SIGNAL/NOISE)2 electron beam
A DQE value of 1 indicates a perfect recorder. "DQE = 0.25" menas
that the signal-to-noise ratio is reduced by half in the
recording step.
(0.5)**2
DQE = --------- = 0.25.
(1.0)**2
0.25
The detector type used for recording images.
Usually film or CCD camera.
This data item is a pointer to attribute id in category entry in the ENTRY category.
The value of attribute id in category em_detector must uniquely identify
the detector used for imaging.
Data items in the EM_ENTITY_ASSEMBLY category
record details about each component of
the complex.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_entity_assemblyCategory>
<PDBx:em_entity_assembly id="1" assembly_id="1">
<PDBx:type>VIRUS</PDBx:type>
</PDBx:em_entity_assembly>
</PDBx:em_entity_assemblyCategory>
Additional details about the component.
The cell from which the component was
obtained.
CHO
HELA
3T3
The cellular location of the component.
cytoplasm
endoplasmic reticulum
plasma membrane
A flag to indicate whether the component is engineered.
The expression system used to produce the component.
eschericia coli
saccharomyces cerevisiae
The plasmid used in the expression system used to produce the component.
pBR322
pMB9
The organelle from which the component was
obtained.
golgi
mitochondrion
cytoskeleton
The common name of the species of the natural organism from which
the component was obtained.
The species of the natural organism from which the component
was obtained.
The strain of the natural organism from which the component was
obtained, if relevant.
DH5a
BMH 71-18
The tissue of the natural organism from which the component was
obtained.
heart
liver
eye lens
The Gene Ontology (GO) identifier for the component.
The GO id is the appropriate identifier used by the Gene Ontology
Consortium. Reference: Nature Genetics vol 25:25-29 (2000).
GO:0005876
GO:0015630
The InterPro (IPR) identifier for the component.
The IPR id is the appropriate identifier used by the Interpro Resource.
Reference: Nucleic Acid Research vol 29(1):37-40(2001).
001304
002353
The name of the component of the observed assembly.
Alternative name of the component.
FADV-1
A description of types of components of the
assembly of the biological structure.
The value of attribute id in category em_entity_assembly must uniquely identify
each of the components of the complex.
This data item is a pointer to attribute id in category em_assembly in the
ASSEMBLY category.
Data items in the EM_ENTITY_ASSEMBLY_LIST category record details
of the structural elements in each component.
Example 1 - microtubule
<PDBx:em_entity_assembly_listCategory>
<PDBx:em_entity_assembly_list entity_assembly_id="1" id="1" entity_id="1">
<PDBx:oligomeric_details>DIMER</PDBx:oligomeric_details>
<PDBx:number_of_copies>2</PDBx:number_of_copies>
</PDBx:em_entity_assembly_list>
</PDBx:em_entity_assembly_listCategory>
The number of copies of the entity.
The oligomeric state of the entity.
This data item is a pointer to attribute id in category em_entity_assembly in
the ENTITY_ASSEMBLY category.
The value of attribute id in category em_entity_assembly_list must uniquely identify
the component.
A pointer to entity id.
Data items in the EM_EULER_ANGLE_DISTRIBUTION category
record details of assignment of Euler angles for projection
sets of particles.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
The euler-alpha angle assignment.
90
The euler-beta angle assignment.
90
Any additional details of the euler angles distribution and assignment.
The euler-gamma angle assignment.
0
The value of attribute id in category em_euler_angle_distribution must
uniquely identify the euler angle assignments of
the projection set used in the final reconstruction.
The value of attribute entry_id in category em_euler_angle_distribution is a pointer
to the ENTRY category.
Data items in the EM_ICOS_VIRUS_SHELLS category record details
of the viral shell number, diameter of each shell and triangulation number.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_icos_virus_shellsCategory>
<PDBx:em_icos_virus_shells virus_entity_id="1" id="1">
<PDBx:shell_diameter>400</PDBx:shell_diameter>
<PDBx:triangulation_num>4</PDBx:triangulation_num>
</PDBx:em_icos_virus_shells>
</PDBx:em_icos_virus_shellsCategory>
The value of the diameter (in angstroms) for each
protein shell of the virus.
The triangulation number (T number) is a geometric and abstract
concept that does not correspond to the structural components of
an individul virus.
It refers to the organisation of the geometric figure.
The triangulation number, T is given by the following relationship:
T= h*2 + hk +k*2, where h and k are positive integers which define the
position of the five-fold vertex on the original hexagonal net.
4
The value of attribute virus_entity_id in category em_icos_virus_shells is
a pointer to attribute id in category em_virus_entity in the VIRUS_ENTITY
category.
The value of attribute id in category em_em_icos_virus_shells must uniquely identify
the number and diameter of each virus protein shell and its
triangulation number.
Data items in the EM_IMAGE_SCANS category record details
of the image scanning device (microdensitometer)
and parameters for digitization of the image.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_image_scansCategory>
<PDBx:em_image_scans entry_id="1DYL" id="2">
<PDBx:number_digital_images>48</PDBx:number_digital_images>
<PDBx:citation_id>1</PDBx:citation_id>
</PDBx:em_image_scans>
</PDBx:em_image_scansCategory>
This data item is a pointer to attribute id
in category citation in the CITATION category.
Any additional details about scanning images.
The number of images scanned and digitised.
The optical density range (OD=-log 10 transmission).
To the eye OD=1 appears light grey and OD=3 is opaque.
1.4
The number of bits per pixel.
8
The sampling step size (microns) set on the scanner.
The scanner model.
This data item is a pointer to attribute id in category entry in the
ENTRY category.
The value of attribute id in category em_image_scans must uniquely identify
the images scanned.
Data items in the EM_IMAGING category record details about
the parameters used in imaging the sample in the electron microscope.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_imagingCategory>
<PDBx:em_imaging entry_id="1DYL" id="1">
<PDBx:sample_support_id>1</PDBx:sample_support_id>
<PDBx:microscope_model>FEI/PHILIPS CM200 FEG</PDBx:microscope_model>
<PDBx:specimen_holder_type>cryotransfer</PDBx:specimen_holder_type>
<PDBx:specimen_holder_model>gatan 626-0300</PDBx:specimen_holder_model>
<PDBx:date>1998-15-06</PDBx:date>
<PDBx:accelerating_voltage>200</PDBx:accelerating_voltage>
<PDBx:illumination_mode>bright field</PDBx:illumination_mode>
<PDBx:mode>low dose</PDBx:mode>
<PDBx:nominal_cs>2.0</PDBx:nominal_cs>
<PDBx:nominal_defocus_min>975</PDBx:nominal_defocus_min>
<PDBx:nominal_defocus_max>7600</PDBx:nominal_defocus_max>
<PDBx:tilt_angle_min>0</PDBx:tilt_angle_min>
<PDBx:tilt_angle_max>0</PDBx:tilt_angle_max>
<PDBx:nominal_magnification>50000</PDBx:nominal_magnification>
<PDBx:electron_source>FEG</PDBx:electron_source>
<PDBx:citation_id>1</PDBx:citation_id>
<PDBx:temperature>95</PDBx:temperature>
</PDBx:em_imaging>
</PDBx:em_imagingCategory>
A value of accelerating voltage (in kV) used for imaging.
300
The magnification value obtained for a known standard just
prior to, during or just after the imaging experiment.
61200
This data item is a pointer to attribute id in category citation in
the CITATION category.
Date (YYYY-MM-DD) of imaging experiment.
2001-05-08
Any additional imaging details.
weak beam illumination
The camera length (in millimeters). The camera length is the
product of the objective focal length and the combined magnification
of the intermediate and projector lenses when the microscope is
operated in the diffraction mode.
The value of attribute detector_id in category em_imaging must uniquely identify
the type of detector used in the experiment.
The electron dose received by the specimen (electrons per square angstrom).
0.9
The source of electrons. The electron gun.
The type of energy filter spectrometer apparatus.
FEI
The energy filter range in electron volts (eV)set by spectrometer.
0 - 15
The mode of illumination.
The name of the model of microscope.
The mode of imaging.
The spherical aberration coefficient (Cs) in millimeters,
of the objective lens.
1.4
The maximum defocus value of the objective lens (in nanometres) used
to obtain the recorded images.
7600
The minimum defocus value of the objective lens (in nanometres) used
to obtain the recorded images.
975
The magnification indicated by the microscope readout.
60000
The specimen temperature maximum (degrees Kelvin) for the duration
of imaging.
The specimen temperature minimum (degrees Kelvin) for the duration
of imaging.
This data item is a pointer to attribute id in category em_sample_support in
the EM_SAMPLE_SUPPORT category.
The value of attribute scans_id in category em_imaging must uniquely identify
the image_scans used in the experiment.
The name of the model of specimen holder used during imaging.
The type of specimen holder used during imaging.
cryo
The mean specimen stage temperature (degrees Kelvin) during imaging
in the microscope.
The maximum angle at which the specimen was tilted to obtain
recorded images.
60
The minimum angle at which the specimen was tilted to obtain
recorded images.
0
This data item is a pointer to attribute id in category entry in the ENTRY category.
The value of attribute id in category em_imaging must uniquely identify
each imaging experiment.
Data items in the EM_SAMPLE_PREPARATION category
record details of sample conditions prior to loading
onto grid support.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_sample_preparationCategory>
<PDBx:em_sample_preparation entry_id="1DYL" id="1">
<PDBx:ph>7.6</PDBx:ph>
<PDBx:buffer_id>1</PDBx:buffer_id>
<PDBx:sample_concentration>5</PDBx:sample_concentration>
</PDBx:em_sample_preparation>
</PDBx:em_sample_preparationCategory>
This data item is a pointer to attribute id
in category em_2d_crystal_grow in the 2D_CRYSTAL_GROW category.
This data item is a pointer to attribute id in category em_buffer in the
BUFFER category.
The pH value of the observed sample buffer.
The value of the concentration (mg/mL for mg per milliliter)
of the complex in the sample.
This data item is a pointer to attribute id
in category em_sample_support in the EM_SAMPLE_SUPPORT category.
The value of attribute id in category em_sample_preparation must
uniquely identify the sample preparation.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the EM_SAMPLE_SUPPORT category record details
of the electron microscope grid type, grid support film and pretreatment
of whole before sample is applied
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_sample_supportCategory>
<PDBx:em_sample_support id="1">
<PDBx:film_material>HOLEY CARBON</PDBx:film_material>
<PDBx:grid_material>COPPER</PDBx:grid_material>
<PDBx:grid_mesh_size>400</PDBx:grid_mesh_size>
<PDBx:grid_type>MESH</PDBx:grid_type>
<PDBx:pretreatment>GLOW DISCHARGE</PDBx:pretreatment>
<PDBx:citation_id>2</PDBx:citation_id>
</PDBx:em_sample_support>
</PDBx:em_sample_supportCategory>
This data item is a pointer to attribute id
in category citation in the CITATION category.
A description of any additional details concerning the sample support.
This grid plus sample was kept at -170 deg C for a month before use
The support material covering the em grid.
The name of the material from which the grid is made.
The value of the mesh size (per inch) of the em grid.
400
A description of the grid type.
A description of the method used to produce the support film.
1%formvar in chloroform cast on distilled water
A description of the grid plus support film pretreatment.
glow-discharged for 30 sec in argon
The value of attribute id in category em_sample_support must uniquely identify
the sample support.
Data items in the EM_VIRUS_ENTITY category record details
of the icosahedral virus.
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_virus_entityCategory>
<PDBx:em_virus_entity id="1" entity_assembly_id="1">
<PDBx:virus_host_category>VERTERBRATES</PDBx:virus_host_category>
<PDBx:virus_host_species>HOMO SAPIENS</PDBx:virus_host_species>
<PDBx:virus_type>VIRUS</PDBx:virus_type>
<PDBx:virus_isolate>STRAIN</PDBx:virus_isolate>
<PDBx:ictvdb_id>00.073.0.01.023</PDBx:ictvdb_id>
<PDBx:enveloped>YES</PDBx:enveloped>
<PDBx:empty>NO</PDBx:empty>
</PDBx:em_virus_entity>
</PDBx:em_virus_entityCategory>
Flag to indicate if the virus is empty or not.
Flag to indicate if the virus is enveloped or not.
The International Committee on Taxonomy of Viruses
(ICTV) Taxon Identifier is the Virus Code used throughout the
ICTV database (ICTVdb). The ICTVdb id is the appropriate
identifier used by the International Committee on Taxonomy of Viruses
Resource. Reference: Virus Taxonomy, Academic Press (1999).
ISBN:0123702003.
01.0.2.0.001
01.0.2.0.002
The host category description for the virus.
The host cell from which the virus was isolated.
HELA
CHO
The host species from which the virus was isolated.
homo sapiens
gallus gallus
The isolate from which the virus was obtained.
The type of virus.
Is the unique identifier for VIRUS_ENTITY category.
This data item is a pointer to attribute id in category em_virus_entity in the
ENTITY_ASSEMBLY category.
Data items in the EM_VITRIFICATION category
record details about the method and cryogen used in
rapid freezing of the sample on the grid prior to its
insertion in the electron microscope
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:em_vitrificationCategory>
<PDBx:em_vitrification entry_id="1DYL" id="1">
<PDBx:sample_preparation_id>1</PDBx:sample_preparation_id>
<PDBx:cryogen_name>ETHANE</PDBx:cryogen_name>
<PDBx:humidity>90</PDBx:humidity>
<PDBx:temp>95</PDBx:temp>
<PDBx:method>PLUNGE VITRIFICATION</PDBx:method>
<PDBx:citation_id>1</PDBx:citation_id>
<PDBx:details> SAMPLES WERE PREPARED AS THIN
LAYERS OF VITREOUS ICE AND
MAINTAINED AT NEAR LIQUID NITROGEN
TEMPERATURE IN THE ELECTRON MICROSCOPE
WITH A GATAN 626-0300 CRYOTRANSFER
HOLDER. </PDBx:details>
</PDBx:em_vitrification>
</PDBx:em_vitrificationCategory>
This data item is a pointer to attribute id in category citation in the
CITATION category.
This is the name of the cryogen.
Any additional details relating to vitrification.
argon atmosphere
The humidity (%) in the vicinity of the vitrification process.
90
The type of instrument used in the vitrification process.
Reichert plunger
The procedure for vitrification.
blot for 2 seconds before plunging
This data item is a pointer to attribute id in category em_sample_preparation in the
EM_SAMPLE_PREPARATION category.
The temperature (in degrees Kelvin) at which vitrification took place.
4.2
The length of time after an event effecting the sample that
vitrification was induced and a description of the event.
30 msec after spraying with effector'
The value of attribute id in category em_vitrification must uniquely identify
the vitrification procedure.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the ENTITY category record details (such as
chemical composition, name, and source) about the molecular
entities that are present in the crystallographic structure.
Items in the various ENTITY sub-categories provide a full
chemical description of these molecular entities.
Entities are of three types: polymer, non-polymer and water.
Note that the water category includes only water; ordered
solvent such as sulfate ion or acetone would be described as
individual non-polymer entities.
The ENTITY category is specific to macromolecular CIF
applications, and replaces the function of the CHEMICAL category
in the CIF core.
It is important to remember that the ENTITY data are not the
result of the crystallographic experiment; those results are
represented in the ATOM_SITE data items. ENTITY data items
describe the chemistry of the molecules under investigation,
and can most usefully be thought of as the ideal groups to which
the structure is restrained or constrained during refinement.
It is also important to remember that entities do not correspond
directly to the enumeration of the contents of the asymmetric
unit. Entities are described only once, even in those structures
that contain multiple observations of an entity. The
STRUCT_ASYM data items, which reference the entity list,
describe and label the contents of the asymmetric unit.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:entityCategory>
<PDBx:entity id="1">
<PDBx:type>polymer</PDBx:type>
<PDBx:formula_weight>10916</PDBx:formula_weight>
<PDBx:details> The enzymatically competent form of HIV protease is a
dimer. This entity corresponds to one monomer of an
active dimer.</PDBx:details>
</PDBx:entity>
<PDBx:entity id="2">
<PDBx:type>non-polymer</PDBx:type>
<PDBx:formula_weight>762</PDBx:formula_weight>
</PDBx:entity>
<PDBx:entity id="3">
<PDBx:type>water</PDBx:type>
<PDBx:formula_weight>18</PDBx:formula_weight>
</PDBx:entity>
</PDBx:entityCategory>
A description of special aspects of the entity.
Formula mass in daltons of the entity.
A description of the entity, with the name of the entity
in parenthesis.
Maps to PDB compound name.
DNA (5'-D(*GP*(CH3)CP*GP*(CH3)CP*GP*C)-3')
PROFLAVINE
PROTEIN (DEOXYRIBONUCLEASE I (E.C.3.1.21.1))
Enzyme Commission (EC) number(s)
2.7.7.7
Experimentally determined formula mass in daltons of the entity
Method used to determine attribute pdbx_formula_weight_exptl in category entity.
MASS SPEC
Entity fragment description(s).
KLENOW FRAGMENT
REPLICASE OPERATOR HAIRPIN
C-TERMINAL DOMAIN
Description(s) of any chemical or post-translational modifications
Details about any entity mutation(s).
Y31H
DEL(298-323)
A place holder for the number of molecules of the entity in
the entry.
1.0
2.0
3.0
An identifier for the parent entity if this entity
is part of a complex entity. For instance a chimeric
entity may be decomposed into several independent
chemical entities where each component entity was
obtained from a different source.
1
2
3
The method by which the sample for the entity was produced.
Entities isolated directly from natural sources (tissues, soil
samples, etc.) are expected to have further information in the
ENTITY_SRC_NAT category. Entities isolated from genetically
manipulated sources are expected to have further information in
the ENTITY_SRC_GEN category.
The value of attribute target_id in category entity points to a target idenitifier
from which this entity was generated.
Defines the type of the entity.
Polymer entities are expected to have corresponding
ENTITY_POLY and associated entries.
Non-polymer entities are expected to have corresponding
CHEM_COMP and associated entries.
Water entities are not expected to have corresponding
entries in the ENTITY category.
The value of attribute id in category entity must uniquely identify a record in the
ENTITY list.
Note that this item need not be a number; it can be any unique
identifier.
Data items in the ENTITY_KEYWORDS category specify keywords
relevant to the molecular entities. Note that this list of
keywords is separate from the list that is used for the
STRUCT_BIOL data items, and is intended to provide only the
information that one would know about the molecular entity *if
one did not know its structure*. Hence polypeptides are simply
polypeptides, and not cytokines or beta-alpha-barrels, and
polyribonucleic acids are simply poly-RNA, and not transfer-
RNA.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:entity_keywordsCategory>
<PDBx:entity_keywords entity_id="1">
<PDBx:text>polypeptide</PDBx:text>
</PDBx:entity_keywords>
<PDBx:entity_keywords entity_id="2">
<PDBx:text>natural product</PDBx:text>
</PDBx:entity_keywords>
<PDBx:entity_keywords entity_id="2">
<PDBx:text>inhibitor</PDBx:text>
</PDBx:entity_keywords>
<PDBx:entity_keywords entity_id="2">
<PDBx:text>reduced peptide</PDBx:text>
</PDBx:entity_keywords>
</PDBx:entity_keywordsCategory>
Enzyme Commission (EC) number(s)
2.7.7.7
Entity fragment description(s).
KLENOW FRAGMENT
REPLICASE OPERATOR HAIRPIN
C-TERMINAL DOMAIN
Entity mutation description(s).
Y31H
DEL(298-323)
Keywords describing this entity.
polypeptide
natural product
polysaccharide
This data item is a pointer to attribute id in category entity in the ENTITY category.
Data items in the ENTITY_LINK category give details about
the linkages between entities.
Example 1 - based on
A description of special aspects of a linkage between
chemical components in the structure.
The entity id of the first of the two entities joined by the
linkage.
This data item is a pointer to attribute id in category entity in the ENTITY
category.
The entity id of the second of the two entities joined by the
linkage.
This data item is a pointer to attribute id in category entity in the ENTITY
category.
For a polymer entity, the sequence number in the first of
the two entities containing the linkage.
This data item is a pointer to attribute num in category entity_poly_seq in the
ENTITY_POLY_SEQ category.
For a polymer entity, the sequence number in the second of
the two entities containing the linkage.
This data item is a pointer to attribute num in category entity_poly_seq in the
ENTITY_POLY_SEQ category.
This data item is a pointer to attribute id in category chem_link in the
CHEM_LINK category.
Data items in the ENTITY_NAME_COM category record the common name
or names associated with the entity. In some cases, the entity
name may not be the same as the name of the biological structure.
For instance, hemoglobin alpha chain would be the entity common
name, not hemoglobin.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:entity_name_comCategory>
<PDBx:entity_name_com entity_id="1" name="HIV-1 protease monomer"></PDBx:entity_name_com>
<PDBx:entity_name_com entity_id="1" name="HIV-1 PR monomer"></PDBx:entity_name_com>
<PDBx:entity_name_com entity_id="2" name="acetyl-pepstatin"></PDBx:entity_name_com>
<PDBx:entity_name_com entity_id="2" name="acetyl-Ile-Val-Asp-Statine-Ala-Ile-Statine"></PDBx:entity_name_com>
<PDBx:entity_name_com entity_id="3" name="water"></PDBx:entity_name_com>
</PDBx:entity_name_comCategory>
This data item is a pointer to attribute id in category entity in the ENTITY category.
A common name for the entity.
HIV protease monomer
hemoglobin alpha chain
2-fluoro-1,4-dichloro benzene
Data items in the ENTITY_NAME_SYS category record the systematic
name or names associated with the entity, and tell which system
was is the source of the systematic name. In some cases, the
entity name may not be the same as the name of the biological
structure. For instance, hemoglobin alpha chain would be the
entity common name, not hemoglobin.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:entity_name_sysCategory>
<PDBx:entity_name_sys entity_id="1" name="ECx.x.x.x"></PDBx:entity_name_sys>
<PDBx:entity_name_sys entity_id="2" name="acetyl-Ile-Val-Asp-Sta-Ala-Ile-Sta"></PDBx:entity_name_sys>
<PDBx:entity_name_sys entity_id="3" name="H(2)0"></PDBx:entity_name_sys>
</PDBx:entity_name_sysCategory>
The system used to generate the systematic name of the entity.
chemical abstracts conventions
enzyme convention
Sigma catalog
This data item is a pointer to attribute id in category entity in the ENTITY category.
The systematic name for the entity.
x,x,pyranoside
EC 2.1.1.1
2-fluoro-1,4-dichloro benzene
Data items in the ENTITY_POLY category record details about the
polymer, such as the type of the polymer, the number of
monomers, and whether it has non-standard features.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:entity_polyCategory>
<PDBx:entity_poly entity_id="1">
<PDBx:type>polypeptide(L)</PDBx:type>
<PDBx:nstd_chirality>no</PDBx:nstd_chirality>
<PDBx:nstd_linkage>no</PDBx:nstd_linkage>
<PDBx:nstd_monomer>no</PDBx:nstd_monomer>
</PDBx:entity_poly>
</PDBx:entity_polyCategory>
A flag to indicate whether or not the polymer contains at least
one monomer unit with chirality different from that specified in
attribute type in category entity_poly.
A flag to indicate whether or not the polymer contains at least
one monomer-to-monomer linkage different from that implied by
attribute type in category entity_poly.
A flag to indicate whether or not the polymer contains at least
one monomer that is not considered standard.
The number of monomers in the polymer.
Chemical sequence expressed as string of one-letter
amino acid codes. Modifications and non-standard
amino acids are coded as X.
A for alanine or adenine
B for ambiguous asparagine/aspartic-acid
R for arginine
N for asparagine
D for aspartic-acid
C for cysteine or cystine or cytosine
Q for glutamine
E for glutamic-acid
Z for ambiguous glutamine/glutamic acid
G for glycine or guanine
H for histidine
I for isoleucine
L for leucine
K for lysine
M for methionine
F for phenylalanine
P for proline
S for serine
T for threonine or thymine
W for tryptophan
Y for tyrosine
V for valine
U for uracil
O for water
X for other
Cannonical chemical sequence expressed as string of
one-letter amino acid codes. Modifications are coded
as the parent amino acid where possible.
A for alanine or adenine
B for ambiguous asparagine/aspartic-acid
R for arginine
N for asparagine
D for aspartic-acid
C for cysteine or cystine or cytosine
Q for glutamine
E for glutamic-acid
Z for ambiguous glutamine/glutamic acid
G for glycine or guanine
H for histidine
I for isoleucine
L for leucine
K for lysine
M for methionine
F for phenylalanine
P for proline
S for serine
T for threonine or thymine
W for tryptophan
Y for tyrosine
V for valine
U for uracil
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGAAFNVEFD
The PDB strand/chain id(s) corresponding to this polymer entity.
A
B
A,B,C
The type of the polymer.
A description of special aspects of the polymer type.
monomer Ala 16 is a D-amino acid
the oligomer contains alternating
RNA and DNA units
This data item is a pointer to attribute id in category entity in the ENTITY category.
Data items in the ENTITY_POLY_SEQ category specify the sequence
of monomers in a polymer. Allowance is made for the possibility
of microheterogeneity in a sample by allowing a given sequence
number to be correlated with more than one monomer id - the
corresponding ATOM_SITE entries should reflect this
heterogeneity.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:entity_poly_seqCategory>
<PDBx:entity_poly_seq entity_id="1" num="1" mon_id="PRO"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="2" mon_id="GLN"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="3" mon_id="ILE"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="4" mon_id="THR"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="5" mon_id="LEU"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="6" mon_id="TRP"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="7" mon_id="GLN"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="8" mon_id="ARG"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="9" mon_id="PRO"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="10" mon_id="LEU"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="11" mon_id="VAL"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="12" mon_id="THR"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="13" mon_id="ILE"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="14" mon_id="LYS"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="15" mon_id="ILE"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="16" mon_id="GLY"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="17" mon_id="GLY"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="18" mon_id="GLN"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="19" mon_id="LEU"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="20" mon_id="LYS"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="21" mon_id="GLU"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="22" mon_id="ALA"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="23" mon_id="LEU"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="24" mon_id="LEU"></PDBx:entity_poly_seq>
<PDBx:entity_poly_seq entity_id="1" num="25" mon_id="ASP"></PDBx:entity_poly_seq>
</PDBx:entity_poly_seqCategory>
A flag to indicate whether or not this monomer in the polymer is
heterogeneous in sequence. This would be a rare phenomenon.
This data item is a pointer to attribute id in category entity in the ENTITY category.
The value of attribute num in category entity_poly_seq must uniquely and sequentially
identify a record in the ENTITY_POLY_SEQ list.
Note that this item must be a number, and that the sequence
numbers must progress in increasing numerical order.
This data item is a pointer to attribute id in category chem_comp in the CHEM_COMP
category.
Data items in the ENTITY_SRC_GEN category record details of
the source from which the entity was obtained, in those cases
where the source was a genetically manipulated one. The
following are treated separately: Items pertaining to the tissue
from which the gene was obtained, items pertaining to the host
organism for gene expression and items pertaining to the actual
producing organism (plasmid).
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:entity_src_genCategory>
<PDBx:entity_src_gen entity_id="1">
<PDBx:gene_src_common_name>HIV-1</PDBx:gene_src_common_name>
<PDBx:gene_src_strain>NY-5</PDBx:gene_src_strain>
<PDBx:host_org_common_name>bacteria</PDBx:host_org_common_name>
<PDBx:host_org_genus>Escherichia</PDBx:host_org_genus>
<PDBx:host_org_species>coli</PDBx:host_org_species>
<PDBx:plasmid_name>pB322</PDBx:plasmid_name>
</PDBx:entity_src_gen>
</PDBx:entity_src_genCategory>
A unique identifier for the expression system. This
should be extracted from a local list of expression
systems.
The common name of the natural organism from which the gene was
obtained.
man
yeast
bacteria
A description of special aspects of the natural organism from
which the gene was obtained.
A string to indicate the life-cycle or cell development
cycle in which the gene is expressed and the mature
protein is active.
The genus of the natural organism from which the gene was
obtained.
Homo
Saccharomyces
Escherichia
The species of the natural organism from which the gene was
obtained.
sapiens
cerevisiae
coli
The strain of the natural organism from which the gene was
obtained, if relevant.
DH5a
BMH 71-18
The tissue of the natural organism from which the gene was
obtained.
heart
liver
eye lens
The sub-cellular fraction of the tissue of the natural organism
from which the gene was obtained.
mitochondria
nucleus
membrane
The common name of the organism that served as host for the
production of the entity.
yeast
bacteria
A description of special aspects of the organism that served as
host for the production of the entity.
The genus of the organism that served as host for the production
of the entity.
Saccharomyces
Escherichia
The species of the organism that served as host for the
production of the entity.
cerevisiae
coli
The strain of the organism that served as host for the
production of the entity.
DH5a
BMH 71-18
Information on the source which is not given elsewhere.
American Type Culture Collection tissue culture number.
6051
Cell type.
ENDOTHELIAL
The specific line of cells.
HELA CELLS
Identifies the location inside (or outside) the cell.
CYTOPLASM
NUCLEUS
A domain or fragment of the molecule.
CYTOPLASM
NUCLEUS
Identifies the gene.
Organized group of tissues that carries on a specialized function.
KIDNEY
LIVER
PANCREAS
Organized structure within cell.
MITOCHONDRIA
The source plasmid.
The source plasmid.
Scientific name of the organism.
ESCHERICHIA COLI
HOMO SAPIENS
SACCHAROMYCES CEREVISIAE
Identifies the variant.
DELTAH1DELTATRP
Americal Tissue Culture Collection of the expression system.
Specific cell type which expressed the molecule.
ENDOTHELIAL
A specific line of cells used as the expression system.
HELA
Identifies the location inside (or outside) the cell which
expressed the molecule.
CYTOPLASM
NUCLEUS
Culture collection of the expression system.
Specific gene which expressed the molecule.
HIV-1 POL
GLNS7
U1A (2-98, Y31H, Q36R)
Specific organ which expressed the molecule.
KIDNEY
Specific organelle which expressed the molecule.
MITOCHONDRIA
The scientific name of the organism that served as host for the
production of the entity.
ESCHERICHIA COLI
HOMO SAPIENS
SACCHAROMYCES CEREVISIAE
ESCHERICHIA COLI
SACCHAROMYCES CEREVISIAE
The strain of the organism in which the entity was
expressed.
AR120
The specific tissue which expressed the molecule.
heart
liver
eye lens
The fraction of the tissue which expressed the
molecule.
mitochondria
nucleus
membrane
Variant of the organism used as the expression system.
TRP-LAC
LAMBDA DE3
Identifies the vector used.
PBIT36
PET15B
PUC18
Identifies the type of vector used (plasmid, virus, or
cosmid).
COSMID
PLASMID
A description of special aspects of the plasmid that produced the
entity in the host organism.
The name of the plasmid that produced the entity in the host
organism.
pET3C
pT123sab
A pointer to attribute id in category pdbx_construct in the PDBX_CONSTRUCT category.
The indentified sequence is the initial construct.
This data item is a pointer to attribute id in category entity in the ENTITY category.
Data items in the ENTITY_SRC_NAT category record details of
the source from which the entity was obtained, in those cases
where the entity was isolated directly from a natural tissue.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:entity_src_natCategory>
<PDBx:entity_src_nat entity_id="2">
<PDBx:common_name>bacteria</PDBx:common_name>
<PDBx:genus>Actinomycetes</PDBx:genus>
<PDBx:species xsi:nil="true" />
<PDBx:details> Acetyl-pepstatin was isolated by Dr. K. Oda, Osaka Prefecture
University, and provided to us by Dr. Ben Dunn, University of Florida,
and Dr. J. Kay, University of Wales.</PDBx:details>
</PDBx:entity_src_nat>
</PDBx:entity_src_natCategory>
The genus of the organism from which the entity was isolated.
man
yeast
bacteria
A description of special aspects of the organism from which the
entity was isolated.
The genus of the organism from which the entity was isolated.
Homo
Saccharomyces
Escherichia
Americal Tissue Culture Collection number.
6051
A particular cell type.
BHK-21
The specific line of cells.
HELA
Identifies the location inside (or outside) the cell.
A domain or fragment of the molecule.
Organized group of tissues that carries on a specialized function.
KIDNEY
Organized structure within cell.
MITOCHONDRIA
Scientific name of the organism of the natural source.
BOS TAURUS
SUS SCROFA
ASPERGILLUS ORYZAE
Details about the plasmid.
PLC28 DERIVATIVE
The plasmid containing the gene.
pB322
Identifies the secretion from which the molecule was isolated.
saliva
urine
venom
Identifies the variant.
The species of the organism from which the entity was isolated.
sapiens
cerevisiae
coli
The strain of the organism from which the entity was isolated.
DH5a
BMH 71-18
The tissue of the organism from which the entity was isolated.
heart
liver
eye lens
The sub-cellular fraction of the tissue of the organism from
which the entity was isolated.
mitochondria
nucleus
membrane
This data item is a pointer to attribute id in category entity in the ENTITY category.
There is only one item in the ENTRY category, attribute id in category entry. This
data item gives a name to this entry, and is indirectly a key to
the categories (such as CELL, GEOM, EXPTL) that describe
information pertinent to the entire data block.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:entryCategory>
<PDBx:entry id="5HVP"></PDBx:entry>
</PDBx:entryCategory>
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer [(1991).
Acta Cryst. C47, 2276-2277].
<PDBx:entryCategory>
<PDBx:entry id="TOZ"></PDBx:entry>
</PDBx:entryCategory>
The value of attribute id in category entry identifies the data block.
Note that this item need not be a number; it can be any unique
identifier.
Data items in the ENTRY_LINK category record the
relationships between the current data block
identified by attribute id in category entry and other data blocks
within the current file which may be referenced
in the current data block.
Example 1 - example file for the one-dimensional incommensurately
modulated structure of K~2~SeO~4~.
<PDBx:entry_linkCategory>
<PDBx:entry_link id="KSE_COM" entry_id="KSE_TEXT">
<PDBx:details>experimental data common to ref./mod. structures</PDBx:details>
</PDBx:entry_link>
<PDBx:entry_link id="KSE_REF" entry_id="KSE_TEXT">
<PDBx:details>reference structure</PDBx:details>
</PDBx:entry_link>
<PDBx:entry_link id="KSE_MOD" entry_id="KSE_TEXT">
<PDBx:details>modulated structure</PDBx:details>
</PDBx:entry_link>
</PDBx:entry_linkCategory>
The description of the relationship between the data blocks
identified _entry_link.id and _entry_link.entry_id.
The value of attribute id in category entry_link identifies a data block
related to the data block identified by attribute id in category entry_link.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the EXPTL category record details about the
growth of the crystal, and about experimental measurements on
the crystal, such as shape, size, density, and so on.
Example 1 - based on laboratory records for Yb(S-C5H4N)2 (THF)4
<PDBx:exptlCategory>
<PDBx:exptl entry_id="datablock1">
<PDBx:absorpt_coefficient_mu>1.22</PDBx:absorpt_coefficient_mu>
<PDBx:absorpt_correction_T_max>0.896</PDBx:absorpt_correction_T_max>
<PDBx:absorpt_correction_T_min>0.802</PDBx:absorpt_correction_T_min>
<PDBx:absorpt_correction_type>integration</PDBx:absorpt_correction_type>
<PDBx:absorpt_process_details>
Gaussian grid method from SHELX76
Sheldrick, G. M., "SHELX-76: structure determination and
refinement program", Cambridge University, UK, 1976</PDBx:absorpt_process_details>
<PDBx:crystals_number>1</PDBx:crystals_number>
<PDBx:details>
Enraf-Nonius LT2 liquid nitrogen variable-temperature device used</PDBx:details>
<PDBx:method>single-crystal x-ray diffraction</PDBx:method>
<PDBx:method_details>
graphite monochromatized Cu K(alpha) fixed tube and
Enraf-Nonius CAD4 diffractometer used</PDBx:method_details>
</PDBx:exptl>
</PDBx:exptlCategory>
The absorption coefficient mu in reciprocal millimetres
calculated from the atomic content of the cell, the density and
the radiation wavelength.
The maximum transmission factors for the crystal and radiation.
These factors are also referred to as the absorption correction
A or 1/A*.
The minimum transmission factors for the crystal and radiation.
These factors are also referred to as the absorption correction
A or 1/A*.
The absorption correction type and method. The value
'empirical' should NOT be used unless no more detailed
information is available.
Description of the absorption process applied to the
intensities. A literature reference should be supplied for
psi-scan techniques.
Tompa analytical
The total number of crystals used in the measurement of
intensities.
Any special information about the experimental work prior to the
intensity measurement. See also attribute preparation in category exptl_crystal.
The method used in the experiment.
single-crystal x-ray diffraction
single-crystal neutron diffraction
single-crystal electron diffraction
fiber x-ray_diffraction
fiber neutron_diffraction
fiber electron_diffraction
single-crystal joint x-ray and neutron diffraction
single-crystal joint x-ray and electron diffraction
solution_ mr
solid-state nmr
theoretical model
other
A description of special aspects of the experimental method.
29 structures
minimized average structure
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the EXPTL_CRYSTAL category record details about
experimental measurements on the crystal or crystals used,
such as shape, size, density, and so on.
Example 1 - based on laboratory records for Yb(S-C5H4N)2 (THF)4
<PDBx:exptl_crystalCategory>
<PDBx:exptl_crystal id="xst2l">
<PDBx:colour>pale yellow</PDBx:colour>
<PDBx:density_diffrn>1.113</PDBx:density_diffrn>
<PDBx:density_Matthews>1.01</PDBx:density_Matthews>
<PDBx:density_meas>1.11</PDBx:density_meas>
<PDBx:density_meas_temp>294.5</PDBx:density_meas_temp>
<PDBx:density_method>neutral buoyancy</PDBx:density_method>
<PDBx:density_percent_sol>0.15</PDBx:density_percent_sol>
<PDBx:description>hexagonal rod, uncut</PDBx:description>
<PDBx:F_000>202</PDBx:F_000>
<PDBx:preparation>
hanging drop, crystal soaked in 10% ethylene glycol for 10 h, then
placed in nylon loop at data collection time</PDBx:preparation>
<PDBx:size_max>0.30</PDBx:size_max>
<PDBx:size_mid>0.20</PDBx:size_mid>
<PDBx:size_min>0.05</PDBx:size_min>
<PDBx:size_rad>0.025</PDBx:size_rad>
</PDBx:exptl_crystal>
</PDBx:exptl_crystalCategory>
The effective number of electrons in the crystal unit cell
contributing to F(000). It may contain dispersion contributions,
and is calculated as
F(000) = [ sum (f~r~^2^ + f~i~^2^) ]^1/2^
f~r~ = real part of the scattering factors at theta = 0
f~i~ = imaginary part of the scattering factors at theta = 0
The colour of the crystal.
dark green
The density of the crystal, expressed as the ratio of the
volume of the asymmetric unit to the molecular mass of a
monomer of the structure, in units of angstroms^3^ per dalton.
Ref: Matthews, B. W. (1960). J. Mol. Biol., 33, 491-497
Density values calculated from crystal cell and contents. The
units are megagrams per cubic metre (grams per cubic centimetre).
Density values measured using standard chemical and physical
methods. The units are megagrams per cubic metre (grams per
cubic centimetre).
The temperature in kelvins at which attribute density_meas
in category exptl_crystal was determined.
The method used to measure attribute density_meas in category exptl_crystal.
Density value P calculated from crystal cell and contents,
expressed as percent solvent.
P = 1 - (1.23 N MMass) / V
N = the number of molecules in the unit cell
MMass = the molecular mass of each molecule (gm/mole)
V = the volume of the unit cell (A^3^)
1.23 = the evaluated conversion factor:
(0.74 cm^3^/gm^3^) (10^24^ A^3^/cm^3^)
--------------------------------------
(6.02*10^23^) moles/molecule
where 0.74 is an assumed value for the partial specific
volume of the molecule
A description of the quality and habit of the crystal.
Dimensional data are better placed in the data items in the
EXPTL_CRYSTAL_FACE category.
The image format for the file containing the image of crystal specified
as an RFC2045/RFC2046 mime type.
jpeg
gif
tiff
The URL for an a file containing the image of crystal.
Details of crystal growth and preparation of the crystal (e.g.
mounting) prior to the intensity measurements.
mounted in an argon-filled quartz capillary
The maximum dimension of the crystal. This item may appear in a
list with attribute id in category exptl_crystal if multiple crystals are used in the
experiment.
The medial dimension of the crystal. This item may appear in a
list with attribute id in category exptl_crystal if multiple crystals are used in the
experiment.
The minimum dimension of the crystal. This item may appear in a
list with attribute id in category exptl_crystal if multiple crystals are used in the
experiment.
The radius of the crystal, if the crystal is a sphere or a
cylinder. This item may appear in a list with attribute id
in category exptl_crystal if multiple crystals are used in the experiment.
The value of attribute id in category exptl_crystal must uniquely identify a record in
the EXPTL_CRYSTAL list.
Note that this item need not be a number; it can be any unique
identifier.
Data items in the EXPTL_CRYSTAL_FACE category record details
of the crystal faces.
Example 1 - based on laboratory records for Yb(S-C5H4N)2 (THF)4
for the 100 face of crystal, xstl1.
<PDBx:exptl_crystal_faceCategory>
<PDBx:exptl_crystal_face crystal_id="xstl1" index_h="1" index_k="0" index_l="0">
<PDBx:diffr_chi>42.56</PDBx:diffr_chi>
<PDBx:diffr_kappa>30.23</PDBx:diffr_kappa>
<PDBx:diffr_phi>-125.56</PDBx:diffr_phi>
<PDBx:diffr_psi>-0.34</PDBx:diffr_psi>
<PDBx:perp_dist>0.025</PDBx:perp_dist>
</PDBx:exptl_crystal_face>
</PDBx:exptl_crystal_faceCategory>
The chi diffractometer setting angle in degrees for a specific
crystal face associated with attribute perp_dist in category exptl_crystal_face.
The kappa diffractometer setting angle in degrees for a specific
crystal face associated with attribute perp_dist in category exptl_crystal_face.
The phi diffractometer setting angle in degrees for a specific
crystal face associated with attribute perp_dist in category exptl_crystal_face.
The psi diffractometer setting angle in degrees for a specific
crystal face associated with attribute perp_dist in category exptl_crystal_face.
The perpendicular distance in millimetres of the face to the
centre of rotation of the crystal.
This data item is a pointer to attribute id in category exptl_crystal in the
EXPTL_CRYSTAL category.
Miller index h of the crystal face associated with the value
attribute perp_dist in category exptl_crystal_face.
Miller index k of the crystal face associated with the value
attribute perp_dist in category exptl_crystal_face.
Miller index l of the crystal face associated with the value
attribute perp_dist in category exptl_crystal_face.
Data items in the EXPTL_CRYSTAL_GROW category record details
about the conditions and methods used to grow the crystal.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:exptl_crystal_growCategory>
<PDBx:exptl_crystal_grow crystal_id="1">
<PDBx:method>hanging drop</PDBx:method>
<PDBx:apparatus>Linbro plates</PDBx:apparatus>
<PDBx:atmosphere>room air</PDBx:atmosphere>
<PDBx:pH>4.7</PDBx:pH>
<PDBx:temp>18(3)</PDBx:temp>
<PDBx:time>approximately 2 days</PDBx:time>
</PDBx:exptl_crystal_grow>
</PDBx:exptl_crystal_growCategory>
The physical apparatus in which the crystal was grown.
Linbro plate
sandwich box
ACA plates
The nature of the gas or gas mixture in which the crystal was
grown.
room air
nitrogen
argon
A description of special aspects of the crystal growth.
Solution 2 was prepared as a well solution and
mixed. A droplet containing 2 \ml of solution
1 was delivered onto a cover slip; 2 \ml of
solution 2 was added to the droplet without
mixing.
Crystal plates were originally stored at room
temperature for 1 week but no nucleation
occurred. They were then transferred to 4
degrees C, at which temperature well formed
single crystals grew in 2 days.
The dependence on pH for successful crystal
growth is very sharp. At pH 7.4 only showers
of tiny crystals grew, at pH 7.5 well formed
single crystals grew, at pH 7.6 no
crystallization occurred at all.
The method used to grow the crystals.
batch precipitation
batch dialysis
hanging drop vapor diffusion
sitting drop vapor diffusion
A literature reference that describes the method used to grow
the crystals.
McPherson et al., 1988
The pH at which the crystal was grown. If more than one pH was
employed during the crystallization process, the final pH should
be noted here and the protocol involving multiple pH values
should be described in attribute details in category exptl_crystal_grow.
7.4
7.6
4.3
Text description of crystal grow procedure.
PEG 4000, potassium phosphate, magnesium chloride, cacodylate
The range of pH values at which the crystal was grown. Used when
a point estimate of pH is not appropriate.
5.6 - 6.4
The ambient pressure in kilopascals at which the crystal was
grown.
The estimated standard deviation of attribute pressure in category exptl_crystal_grow.
A description of the protocol used for seeding the crystal
growth.
macroseeding
Microcrystals were introduced from a previous
crystal growth experiment by transfer with a
human hair.
A literature reference that describes the protocol used to seed
the crystal.
Stura et al., 1989
The temperature in kelvins at which the crystal was grown.
If more than one temperature was employed during the
crystallization process, the final temperature should be noted
here and the protocol involving multiple temperatures should be
described in attribute details in category exptl_crystal_grow.
A description of special aspects of temperature control during
crystal growth.
The estimated standard deviation of attribute temp in category exptl_crystal_grow.
The approximate time that the crystal took to grow to the size
used for data collection.
overnight
2-4 days
6 months
This data item is a pointer to attribute id in category exptl_crystal in the
EXPTL_CRYSTAL category.
Data items in the EXPTL_CRYSTAL_GROW_COMP category record
details about the components of the solutions that were 'mixed'
(by whatever means) to produce the crystal.
In general, solution 1 is the solution that contains the
molecule to be crystallized and solution 2 is the solution
that contains the precipitant. However, the number of solutions
required to describe the crystallization protocol is not limited
to 2.
Details of the crystallization protocol should be described in
EXPTL_CRYSTAL_GROW_DETAILS, using the solutions described in
EXPTL_CRYSTAL_GROW_COMP.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:exptl_crystal_grow_compCategory>
<PDBx:exptl_crystal_grow_comp crystal_id="1" id="1">
<PDBx:sol_id>1</PDBx:sol_id>
<PDBx:name>HIV-1 protease</PDBx:name>
<PDBx:volume>0.002 ml</PDBx:volume>
<PDBx:conc>6 mg/ml</PDBx:conc>
<PDBx:details> The protein solution was in a buffer containing 25 mM NaCl, 100 mM NaMES/
MES buffer, pH 7.5, 3 mM NaAzide</PDBx:details>
</PDBx:exptl_crystal_grow_comp>
<PDBx:exptl_crystal_grow_comp crystal_id="1" id="2">
<PDBx:sol_id>2</PDBx:sol_id>
<PDBx:name>NaCl</PDBx:name>
<PDBx:volume>0.200 ml</PDBx:volume>
<PDBx:conc>4 M</PDBx:conc>
<PDBx:details>in 3 mM NaAzide</PDBx:details>
</PDBx:exptl_crystal_grow_comp>
<PDBx:exptl_crystal_grow_comp crystal_id="1" id="3">
<PDBx:sol_id>2</PDBx:sol_id>
<PDBx:name>Acetic Acid</PDBx:name>
<PDBx:volume>0.047 ml</PDBx:volume>
<PDBx:conc>100 mM</PDBx:conc>
<PDBx:details>in 3 mM NaAzide</PDBx:details>
</PDBx:exptl_crystal_grow_comp>
<PDBx:exptl_crystal_grow_comp crystal_id="1" id="4">
<PDBx:sol_id>2</PDBx:sol_id>
<PDBx:name>Na Acetate</PDBx:name>
<PDBx:volume>0.053 ml</PDBx:volume>
<PDBx:conc>100 mM</PDBx:conc>
<PDBx:details> in 3 mM NaAzide. Buffer components were mixed to produce a pH of 4.7
according to a ratio calculated from the pKa. The actual pH of solution 2
was not measured.</PDBx:details>
</PDBx:exptl_crystal_grow_comp>
<PDBx:exptl_crystal_grow_comp crystal_id="1" id="5">
<PDBx:sol_id>2</PDBx:sol_id>
<PDBx:name>water</PDBx:name>
<PDBx:volume>0.700 ml</PDBx:volume>
<PDBx:conc>neat</PDBx:conc>
<PDBx:details>in 3 mM NaAzide</PDBx:details>
</PDBx:exptl_crystal_grow_comp>
</PDBx:exptl_crystal_grow_compCategory>
The concentration of the solution component.
200 \ml
0.1 ml
A description of any special aspects of the solution component.
When the solution component is the one that contains the
macromolecule, this could be the specification of the buffer in
which the macromolecule was stored. When the solution component
is a buffer component, this could be the methods (or formula)
used to achieve a desired pH.
in 3 mM NaAzide
The protein solution was in a buffer
containing 25 mM NaCl, 100 mM NaMES/MES
buffer, pH 7.5, 3 mM NaAzide
in 3 mM NaAzide. Buffer components were mixed
to produce a pH of 4.7 according to a ratio
calculated from the pKa. The actual pH of
solution 2 was not measured.
A common name for the component of the solution.
protein in buffer
acetic acid
An identifier for the solution to which the given solution
component belongs.
1
well solution
solution A
The volume of the solution component.
200 \ml
0.1 ml
The value of attribute id in category exptl_crystal_grow_comp must uniquely identify
each item in the EXPTL_CRYSTAL_GROW_COMP list.
Note that this item need not be a number; it can be any unique
identifier.
1
A
protein in buffer
This data item is a pointer to attribute id in category exptl_crystal in the
EXPTL_CRYSTAL category.
Data items in the GEOM and related (GEOM_ANGLE,
GEOM_BOND, GEOM_CONTACT, GEOM_HBOND and GEOM_TORSION)
categories record details about the molecular and crystal
geometry, as calculated from the contents of the ATOM, CELL,
and SYMMETRY data.
Geometry data are therefore redundant, in that they can be
calculated from other more fundamental quantities in the data
block. They serve, however, the dual purpose of providing a
check on the correctness of both sets of data, and of enabling
the most important geometric data to be identified for
publication by setting the appropriate publication flag.
The description of geometrical information not covered by the
existing data names in the GEOM categories, such as
least-squares planes.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the GEOM_ANGLE category record details about the
molecular and crystal angles, as calculated from the contents
of the ATOM, CELL, and SYMMETRY data.
Example 1 - based on data set TOZ of Willis, Beckwith & Tozer [(1991).
Acta Cryst. C47, 2276-2277].
<PDBx:geom_angleCategory>
<PDBx:geom_angle atom_site_id_1="C2" atom_site_id_2="O1" atom_site_id_3="C5" site_symmetry_1="1_555" site_symmetry_2="1_555" site_symmetry_3="1_555">
<PDBx:value>111.6(2)</PDBx:value>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_angle>
<PDBx:geom_angle atom_site_id_1="O1" atom_site_id_2="C2" atom_site_id_3="C3" site_symmetry_1="1_555" site_symmetry_2="1_555" site_symmetry_3="1_555">
<PDBx:value>110.9(2)</PDBx:value>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_angle>
<PDBx:geom_angle atom_site_id_1="O1" atom_site_id_2="C2" atom_site_id_3="O21" site_symmetry_1="1_555" site_symmetry_2="1_555" site_symmetry_3="1_555">
<PDBx:value>122.2(3)</PDBx:value>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_angle>
<PDBx:geom_angle atom_site_id_1="C3" atom_site_id_2="C2" atom_site_id_3="O21" site_symmetry_1="1_555" site_symmetry_2="1_555" site_symmetry_3="1_555">
<PDBx:value>127.0(3)</PDBx:value>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_angle>
<PDBx:geom_angle atom_site_id_1="C2" atom_site_id_2="C3" atom_site_id_3="N4" site_symmetry_1="1_555" site_symmetry_2="1_555" site_symmetry_3="1_555">
<PDBx:value>101.3(2)</PDBx:value>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_angle>
<PDBx:geom_angle atom_site_id_1="C2" atom_site_id_2="C3" atom_site_id_3="C31" site_symmetry_1="1_555" site_symmetry_2="1_555" site_symmetry_3="1_555">
<PDBx:value>111.3(2)</PDBx:value>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_angle>
<PDBx:geom_angle atom_site_id_1="C2" atom_site_id_2="C3" atom_site_id_3="H3" site_symmetry_1="1_555" site_symmetry_2="1_555" site_symmetry_3="1_555">
<PDBx:value>107(1)</PDBx:value>
</PDBx:geom_angle>
<PDBx:geom_angle atom_site_id_1="N4" atom_site_id_2="C3" atom_site_id_3="C31" site_symmetry_1="1_555" site_symmetry_2="1_555" site_symmetry_3="1_555">
<PDBx:value>116.7(2)</PDBx:value>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_angle>
</PDBx:geom_angleCategory>
An optional identifier of the first of the three atom sites that
define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the three atom sites
that define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the three atom sites that
define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the three atom sites that
define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the three atom sites
that define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the three atom sites that
define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the three atom sites that
define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the three atom sites
that define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the three atom sites that
define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the three atom sites that
define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the three atom sites
that define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the three atom sites that
define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the three atom sites that
define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute label_alt_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the three atom sites
that define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute label_alt_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the three atom sites that
define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute label_alt_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the three atom sites that
define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the three atom sites
that define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the three atom sites that
define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the three atom sites that
define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the three atom sites
that define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the three atom sites that
define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the three atom sites that
define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the three atom sites
that define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the three atom sites that
define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the three atom sites that
define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the three atom sites
that define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the three atom sites that
define the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
Pointer to attribute pdbx_PDB_model_num in category atom_site
Pointer to attribute pdbx_PDB_ins_code in category atom_site.
Pointer to attribute pdbx_PDB_ins_code in category atom_site.
Pointer to attribute pdbx_PDB_ins_code in category atom_site.
This code signals if the angle is referred to in a publication or
should be placed in a table of significant angles.
Angle in degrees bounded by the three sites
_geom_angle.atom_site_id_1, _geom_angle.atom_site_id_2 and
attribute atom_site_id_3 in category geom_angle.
The estimated standard deviation of attribute value in category geom_angle.
The identifier of the first of the three atom sites that define
the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute id in category atom_site in the ATOM_SITE
category.
The identifier of the second of the three atom sites that define
the angle specified by attribute value in category geom_angle. The second atom is
taken to be the apex of the angle.
This data item is a pointer to attribute id in category atom_site in the ATOM_SITE
category.
The identifier of the third of the three atom sites that define
the angle specified by attribute value.
in category geom_angle
This data item is a pointer to attribute id in category atom_site in the ATOM_SITE
category.
The symmetry code of the first of the three atom sites that
define the angle specified by attribute in category geom_angle.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
The symmetry code of the second of the three atom sites that
define the angle specified by attribute in category geom_angle.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
The symmetry code of the third of the three atom sites that
define the angle specified by attribute in category geom_angle.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
Data items in the GEOM_BOND category record details about
molecular and crystal bonds, as calculated from the contents
of the ATOM, CELL, and SYMMETRY data.
Example 1 - based on data set TOZ of Willis, Beckwith & Tozer [(1991).
Acta Cryst. C47, 2276-2277].
<PDBx:geom_bondCategory>
<PDBx:geom_bond atom_site_id_1="O1" atom_site_id_2="C2" site_symmetry_1="1_555" site_symmetry_2="1_555">
<PDBx:dist>1.342(4)</PDBx:dist>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_bond>
<PDBx:geom_bond atom_site_id_1="O1" atom_site_id_2="C5" site_symmetry_1="1_555" site_symmetry_2="1_555">
<PDBx:dist>1.439(3)</PDBx:dist>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_bond>
<PDBx:geom_bond atom_site_id_1="C2" atom_site_id_2="C3" site_symmetry_1="1_555" site_symmetry_2="1_555">
<PDBx:dist>1.512(4)</PDBx:dist>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_bond>
<PDBx:geom_bond atom_site_id_1="C2" atom_site_id_2="O21" site_symmetry_1="1_555" site_symmetry_2="1_555">
<PDBx:dist>1.199(4)</PDBx:dist>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_bond>
<PDBx:geom_bond atom_site_id_1="C3" atom_site_id_2="N4" site_symmetry_1="1_555" site_symmetry_2="1_555">
<PDBx:dist>1.465(3)</PDBx:dist>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_bond>
<PDBx:geom_bond atom_site_id_1="C3" atom_site_id_2="C31" site_symmetry_1="1_555" site_symmetry_2="1_555">
<PDBx:dist>1.537(4)</PDBx:dist>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_bond>
<PDBx:geom_bond atom_site_id_1="C3" atom_site_id_2="H3" site_symmetry_1="1_555" site_symmetry_2="1_555">
<PDBx:dist>1.00(3)</PDBx:dist>
</PDBx:geom_bond>
<PDBx:geom_bond atom_site_id_1="N4" atom_site_id_2="C5" site_symmetry_1="1_555" site_symmetry_2="1_555">
<PDBx:dist>1.472(3)</PDBx:dist>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_bond>
</PDBx:geom_bondCategory>
An optional identifier of the first of the two atom sites that
define the bond specified by attribute dist.
in category geom_bond
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the bond specified by attribute dist.
in category geom_bond
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the bond specified by attribute dist.
in category geom_bond
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the bond specified by attribute dist.
in category geom_bond
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the bond specified by attribute dist.
in category geom_bond
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the bond specified by attribute dist.
in category geom_bond
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the bond specified by attribute dist.
in category geom_bond
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the bond specified by attribute dist.
in category geom_bond
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the bond specified by attribute dist.
in category geom_bond
This data item is a pointer to attribute label_alt_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the bond specified by attribute dist.
in category geom_bond
This data item is a pointer to attribute label_alt_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the bond specified by attribute dist.
in category geom_bond
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the bond specified by attribute dist.
in category geom_bond
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the bond specified by attribute dist.
in category geom_bond
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the bond specified by attribute dist.
in category geom_bond
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the bond specified by attribute dist.
in category geom_bond
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the bond specified by attribute dist.
in category geom_bond
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the bond specified by attribute dist.
in category geom_bond
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the bond specified by attribute dist.
in category geom_bond
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
The intramolecular bond distance in angstroms.
The estimated standard deviation of attribute dist in category geom_bond.
Pointer to attribute pdbx_PDB_model_num in category atom_site
Pointer to attribute pdbx_PDB_ins_code in category atom_site.
Pointer to attribute pdbx_PDB_ins_code in category atom_site.
This code signals if the bond distance is referred to in a
publication or should be placed in a list of significant bond
distances.
The identifier of the first of the two atom sites that define the
bond specified by attribute dist.
in category geom_bond
This data item is a pointer to attribute id in category atom_site in the ATOM_SITE
category.
The identifier of the second of the two atom sites that define
the bond specified by attribute dist.
in category geom_bond
This data item is a pointer to attribute id in category atom_site in the ATOM_SITE
category.
The symmetry code of the first of the two atom sites that
define the bond specified by attribute dist in category geom_bond.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
The symmetry code of the second of the two atom sites that
define the bond specified by attribute dist in category geom_bond.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
Data items in the GEOM_CONTACT category record details about
molecular and crystal contacts, as calculated from the contents
of the ATOM, CELL, and SYMMETRY data.
Example 1 - based on data set CLPHO6 of Ferguson, Ruhl, McKervey & Browne
(1991). Acta Cryst. C48, 2262-2264].
<PDBx:geom_contactCategory>
<PDBx:geom_contact atom_site_id_1="O(1)" atom_site_id_2="O(2)" site_symmetry_1="" site_symmetry_2="">
<PDBx:dist>2.735(3)</PDBx:dist>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_contact>
<PDBx:geom_contact atom_site_id_1="H(O1)" atom_site_id_2="O(2)" site_symmetry_1="" site_symmetry_2="">
<PDBx:dist>1.82</PDBx:dist>
<PDBx:publ_flag>no</PDBx:publ_flag>
</PDBx:geom_contact>
</PDBx:geom_contactCategory>
An optional identifier of the first of the two atom sites that
define the contact specified by attribute dist.
in category geom_contact
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the contact specified by attribute dist.
in category geom_contact
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the contact specified by attribute dist.
in category geom_contact
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the contact specified by attribute dist.
in category geom_contact
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the contact specified by attribute dist.
in category geom_contact
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the contact specified by attribute dist.
in category geom_contact
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the contact specified by attribute dist.
in category geom_contact
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the contact specified by attribute dist.
in category geom_contact
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the contact specified by attribute dist.
in category geom_contact
This data item is a pointer to attribute label_alt_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the contact specified by attribute dist.
in category geom_contact
This data item is a pointer to attribute label_alt_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the contact specified by attribute dist.
in category geom_contact
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the contact specified by attribute dist.
in category geom_contact
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the contact specified by attribute dist.
in category geom_contact
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the contact specified by attribute dist.
in category geom_contact
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the contact specified by attribute dist.
in category geom_contact
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the contact specified by attribute dist.
in category geom_contact
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the two atom sites that
define the contact specified by attribute dist.
in category geom_contact
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the two atom sites that
define the contact specified by attribute dist.
in category geom_contact
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
The interatomic contact distance in angstroms.
The estimated standard deviation of attribute dist in category geom_contact.
Pointer to attribute pdbx_PDB_model_num in category atom_site
Pointer to attribute pdbx_PDB_ins_code in category atom_site.
Pointer to attribute pdbx_PDB_ins_code in category atom_site.
This code signals if the contact distance is referred to in a
publication or should be placed in a list of significant contact
distances.
The identifier of the first of the two atom sites that define the
contact specified by attribute dist.
in category geom_contact
This data item is a pointer to attribute id in category atom_site in the ATOM_SITE
category.
The identifier of the second of the two atom sites that define
the contact specified by attribute dist.
in category geom_contact
This data item is a pointer to attribute id in category atom_site in the ATOM_SITE
category.
The symmetry code of the first of the two atom sites that
define the contact specified by attribute dist in category geom_contact.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
The symmetry code of the second of the two atom sites that
define the contact specified by attribute dist in category geom_contact.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
Data items in the GEOM_HBOND category record details about
hydrogen bonds, as calculated from the contents of the ATOM,
CELL, and SYMMETRY data.
Example 1 - based on C~14~H~13~ClN~2~O.H~2~O, reported by Palmer,
Puddle & Lisgarten [(1993). Acta Cryst. C49, 1777-1779].
<PDBx:geom_hbondCategory>
<PDBx:geom_hbond atom_site_id_D="N6" atom_site_id_H="HN6" atom_site_id_A="OW">
<PDBx:dist_DH>0.888(8)</PDBx:dist_DH>
<PDBx:dist_HA>1.921(12)</PDBx:dist_HA>
<PDBx:dist_DA>2.801(8)</PDBx:dist_DA>
<PDBx:angle_DHA>169.6(8)</PDBx:angle_DHA>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_hbond>
<PDBx:geom_hbond atom_site_id_D="OW" atom_site_id_H="HO2" atom_site_id_A="O7">
<PDBx:dist_DH>0.917(6)</PDBx:dist_DH>
<PDBx:dist_HA>1.923(12)</PDBx:dist_HA>
<PDBx:dist_DA>2.793(8)</PDBx:dist_DA>
<PDBx:angle_DHA>153.5(8)</PDBx:angle_DHA>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_hbond>
<PDBx:geom_hbond atom_site_id_D="OW" atom_site_id_H="HO1" atom_site_id_A="N10">
<PDBx:dist_DH>0.894(8)</PDBx:dist_DH>
<PDBx:dist_HA>1.886(11)</PDBx:dist_HA>
<PDBx:dist_DA>2.842(8)</PDBx:dist_DA>
<PDBx:angle_DHA>179.7(9)</PDBx:angle_DHA>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_hbond>
</PDBx:geom_hbondCategory>
The angle in degrees defined by the donor, hydrogen and acceptor
atom sites in a hydrogen bond.
The standard uncertainty (e.s.d) of attribute angle_DHA in category geom_hbond.
An optional identifier of the acceptor atom site that defines
the hydrogen bond.
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the donor atom site that defines
the hydrogen bond.
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the hydrogen atom site that defines
the hydrogen bond.
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the acceptor atom site that defines
the hydrogen bond.
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the donor atom site that defines
the hydrogen bond.
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the hydrogen atom site that defines
the hydrogen bond.
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the acceptor atom site that defines
the hydrogen bond.
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the donor atom site that defines
the hydrogen bond.
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the hydrogen atom site that defines
the hydrogen bond.
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the acceptor atom site that defines
the hydrogen bond.
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the donor atom site that defines
the hydrogen bond.
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the hydrogen atom site that defines
the hydrogen bond.
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the acceptor atom site that defines
the hydrogen bond.
This data item is a pointer to attribute label_alt_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the donor atom site that defines
the hydrogen bond.
This data item is a pointer to attribute label_alt_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the hydrogen atom site that defines
the hydrogen bond.
This data item is a pointer to attribute label_alt_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the acceptor atom site that defines
the hydrogen bond.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the donor atom site that defines
the hydrogen bond.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the hydrogen atom site that defines
the hydrogen bond.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the acceptor atom site that defines
the hydrogen bond.
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the donor atom site that defines
the hydrogen bond.
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the hydrogen atom site that defines
the hydrogen bond.
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the acceptor atom site that defines
the hydrogen bond.
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the donor atom site that defines
the hydrogen bond.
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the hydrogen atom site that defines
the hydrogen bond.
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the acceptor atom site that defines
the hydrogen bond.
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the donor atom site that defines
the hydrogen bond.
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the hydrogen atom site that defines
the hydrogen bond.
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
The distance in angstroms between the donor and acceptor atom
sites in a hydrogen bond.
The standard undercertainty (e.s.d) in angstroms of
attribute dist_DA in category geom_hbond.
The distance in angstroms between the donor and hydrogen atom
sites in a hydrogen bond.
The standard undercertainty (e.s.d) in angstroms of
attribute dist_DH in category geom_hbond.
The distance in angstroms between the hydrogen and acceptor
atom sites in a hydrogen bond.
The standard undercertainty (e.s.d) in angstroms of
attribute dist_HA in category geom_hbond.
This code signals if the hydrogen bond information is referred
to in a publication or should be placed in a table of significant
hydrogen-bond geometry.
The identifier of the acceptor atom site that defines the
hydrogen bond.
This data item is a pointer to attribute id in category atom_site in the ATOM_SITE
category.
The identifier of the donor atom site that defines the hydrogen
bond.
This data item is a pointer to attribute id in category atom_site in the ATOM_SITE
category.
The identifier of the hydrogen atom site that defines the
hydrogen bond.
This data item is a pointer to attribute id in category atom_site in the ATOM_SITE
category.
The symmetry code of the acceptor atom site that defines the
hydrogen bond.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
The symmetry code of the donor atom site that defines the
hydrogen bond.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
The symmetry code of the hydrogen atom site that defines the
hydrogen bond.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
Data items in the GEOM_TORSION category record details about
molecular and crystal torsion angles, as calculated from the
contents of the ATOM, CELL, and SYMMETRY data.
The vector direction attribute atom_site_id_2 in category geom_torsion to
attribute atom_site_id_3 in category geom_torsion is the viewing direction, and the
torsion angle is the angle of twist required to superimpose the
projection of the vector site2-site1 onto the projection of the
vector site3-site4. Clockwise torsions are positive,
anticlockwise torsions are negative.
Ref: Klyne, W. & Prelog, V. (1960). Experientia, 16, 521-523.
Example 3 - based on data set CLPHO6 of Ferguson, Ruhl, McKervey & Browne
[(1991). Acta Cryst. C48, 2262-2264].
<PDBx:geom_torsionCategory>
<PDBx:geom_torsion atom_site_id_1="C(9)" atom_site_id_2="O(2)" atom_site_id_3="C(7)" atom_site_id_4="C(2)" site_symmetry_1="" site_symmetry_2="" site_symmetry_3="" site_symmetry_4="">
<PDBx:value>71.8</PDBx:value>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_torsion>
<PDBx:geom_torsion atom_site_id_1="C(7)" atom_site_id_2="O(2)" atom_site_id_3="C(9)" atom_site_id_4="C(10)" site_symmetry_1="" site_symmetry_2="" site_symmetry_3="" site_symmetry_4="2_666">
<PDBx:value>-168.0</PDBx:value>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_torsion>
<PDBx:geom_torsion atom_site_id_1="C(10)" atom_site_id_2="O(3)" atom_site_id_3="C(8)" atom_site_id_4="C(6)" site_symmetry_1="" site_symmetry_2="" site_symmetry_3="" site_symmetry_4="">
<PDBx:value>-167.7</PDBx:value>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_torsion>
<PDBx:geom_torsion atom_site_id_1="C(8)" atom_site_id_2="O(3)" atom_site_id_3="C(10)" atom_site_id_4="C(9)" site_symmetry_1="" site_symmetry_2="" site_symmetry_3="" site_symmetry_4="2_666">
<PDBx:value>-69.7</PDBx:value>
<PDBx:publ_flag>yes</PDBx:publ_flag>
</PDBx:geom_torsion>
<PDBx:geom_torsion atom_site_id_1="O(1)" atom_site_id_2="C(1)" atom_site_id_3="C(2)" atom_site_id_4="C(3)" site_symmetry_1="" site_symmetry_2="" site_symmetry_3="" site_symmetry_4="">
<PDBx:value>-179.5</PDBx:value>
<PDBx:publ_flag>no</PDBx:publ_flag>
</PDBx:geom_torsion>
<PDBx:geom_torsion atom_site_id_1="O(1)" atom_site_id_2="C(1)" atom_site_id_3="C(2)" atom_site_id_4="C(7)" site_symmetry_1="" site_symmetry_2="" site_symmetry_3="" site_symmetry_4="">
<PDBx:value>-0.6</PDBx:value>
<PDBx:publ_flag>no</PDBx:publ_flag>
</PDBx:geom_torsion>
</PDBx:geom_torsionCategory>
An optional identifier of the first of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the fourth of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the fourth of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the fourth of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the fourth of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute label_alt_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute label_alt_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute label_alt_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the fourth of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute label_alt_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the fourth of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the fourth of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the fourth of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the first of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the second of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the third of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
An optional identifier of the fourth of the four atom sites that
define the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
Pointer to attribute pdbx_PDB_model_num in category atom_site
Pointer to attribute pdbx_PDB_ins_code in category atom_site.
Pointer to attribute pdbx_PDB_ins_code in category atom_site.
Pointer to attribute pdbx_PDB_ins_code in category atom_site.
Pointer to attribute pdbx_PDB_ins_code in category atom_site.
This code signals if the torsion angle is referred to in a
publication or should be placed in a table of significant
torsion angles.
The value of the torsion angle in degrees.
The estimated standard deviation of attribute value in category geom_torsion.
The identifier of the first of the four atom sites that define
the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute id in category atom_site in the ATOM_SITE
category.
The identifier of the second of the four atom sites that define
the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute id in category atom_site in the ATOM_SITE
category.
The identifier of the third of the four atom sites that define
the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute id in category atom_site in the ATOM_SITE
category.
The identifier of the fourth of the four atom sites that define
the torsion angle specified by attribute value.
in category geom_torsion
This data item is a pointer to attribute id in category atom_site in the ATOM_SITE
category.
The symmetry code of the first of the four atom sites that
define the torsion angle specified by attribute value in category geom_torsion.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
The symmetry code of the second of the four atom sites that
define the torsion angle specified by attribute value in category geom_torsion.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
The symmetry code of the third of the four atom sites that
define the torsion angle specified by attribute value in category geom_torsion.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
The symmetry code of the fourth of the four atom sites that
define the torsion angle specified by attribute value in category geom_torsion.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
Data items in the JOURNAL category record details about the
book keeping entries used by the journal's staff when processing
a data block submitted for publication.
Normally the creator of a data block will not specify these data.
The data names are not defined in the dictionary because they are
for journal use only.
Example 1 - based on Acta Cryst. file for entry HL0007 [Willis, Beckwith
& Tozer (1991). Acta Cryst. C47, 2276-2277].
<PDBx:journalCategory>
<PDBx:journal entry_id="TOZ">
<PDBx:date_recd_electronic>1991-04-15</PDBx:date_recd_electronic>
<PDBx:date_from_coeditor>1991-04-18</PDBx:date_from_coeditor>
<PDBx:date_accepted>1991-04-18</PDBx:date_accepted>
<PDBx:date_printers_first>1991-08-07</PDBx:date_printers_first>
<PDBx:date_proofs_out>1991-08-07</PDBx:date_proofs_out>
<PDBx:coeditor_code>HL0007</PDBx:coeditor_code>
<PDBx:techeditor_code>C910963</PDBx:techeditor_code>
<PDBx:coden_ASTM>ACSCEE</PDBx:coden_ASTM>
<PDBx:name_full>Acta Crystallographica Section C</PDBx:name_full>
<PDBx:year>1991</PDBx:year>
<PDBx:volume>47</PDBx:volume>
<PDBx:issue>NOV91</PDBx:issue>
<PDBx:page_first>2276</PDBx:page_first>
<PDBx:page_last>2277</PDBx:page_last>
</PDBx:journal>
</PDBx:journalCategory>
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
Journal data items are defined by the journal staff.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the JOURNAL_INDEX category are used to list terms
employed in generating the journal indexes.
Normally the creator of a data block will not specify these data
items.
Example 1 - based on a paper by Zhu, Reynolds, Klein & Trudell [(1994).
Acta Cryst. C50, 2067-2069].
<PDBx:journal_indexCategory>
<PDBx:journal_index type="S" term="alkaloids">
<PDBx:subterm>(-)-norcocaine</PDBx:subterm>
</PDBx:journal_index>
</PDBx:journal_indexCategory>
Journal index data items are defined by the journal staff.
Journal index data items are defined by the journal staff.
Journal index data items are defined by the journal staff.
Placeholder category for PDB coordinate data.
Data items in the NDB_STRUCT_CONF_NA category
describes secondary structure features in this entry.
This data item counts the number of occurences of
this feature in this entry.
This data item is a pointer to attribute id in category entry in the
ENTRY category.
This data item identifies a secondary structure
feature of this entry.
Data items in the NDB_STRUCT_FEATURE_NA category
describes tertiary and other special structural
features in this entry.
This data item counts the number of occurences of
this feature in this entry.
This data item is a pointer to attribute id in category entry in the
ENTRY category.
This data item identifies a structural
feature of this entry.
Data items in the NDB_STRUCT_NA_BASE_PAIR category record details
of base pairing interactions.
<PDBx:ndb_struct_na_base_pairCategory>
<PDBx:ndb_struct_na_base_pair model_number="1" i_label_comp_id="G" i_label_asym_id="A" i_label_seq_id="1" i_symmetry="1_555" j_label_comp_id="C" j_label_asym_id="A" j_label_seq_id="8" j_symmetry="7_555">
<PDBx:shear>-0.396</PDBx:shear>
<PDBx:stretch>-0.156</PDBx:stretch>
<PDBx:stagger>-0.018</PDBx:stagger>
<PDBx:buckle>-5.523</PDBx:buckle>
<PDBx:propeller>-6.752</PDBx:propeller>
<PDBx:opening>-3.291</PDBx:opening>
</PDBx:ndb_struct_na_base_pair>
<PDBx:ndb_struct_na_base_pair model_number="1" i_label_comp_id="G" i_label_asym_id="A" i_label_seq_id="2" i_symmetry="1_555" j_label_comp_id="C" j_label_asym_id="A" j_label_seq_id="7" j_symmetry="7_555">
<PDBx:shear>-0.094</PDBx:shear>
<PDBx:stretch>-0.220</PDBx:stretch>
<PDBx:stagger>-0.334</PDBx:stagger>
<PDBx:buckle>-4.727</PDBx:buckle>
<PDBx:propeller>-9.765</PDBx:propeller>
<PDBx:opening>2.311</PDBx:opening>
</PDBx:ndb_struct_na_base_pair>
<PDBx:ndb_struct_na_base_pair model_number="1" i_label_comp_id="G" i_label_asym_id="A" i_label_seq_id="3" i_symmetry="1_555" j_label_comp_id="C" j_label_asym_id="A" j_label_seq_id="6" j_symmetry="7_555">
<PDBx:shear>-0.285</PDBx:shear>
<PDBx:stretch>-0.239</PDBx:stretch>
<PDBx:stagger>0.008</PDBx:stagger>
<PDBx:buckle>-6.454</PDBx:buckle>
<PDBx:propeller>-12.575</PDBx:propeller>
<PDBx:opening>-1.181</PDBx:opening>
</PDBx:ndb_struct_na_base_pair>
</PDBx:ndb_struct_na_base_pairCategory>
The value of the base pair buckle parameter.
Base pair classification of Westhoff and Leontis.
Base pair classification of Saenger
Describes the PDB insertion code of the i-th base in the base pair.
This data item is a pointer to attribute pdbx_PDB_ins_code in category atom_site in the
ATOM_SITE category.
Describes the asym id of the i-th base in the base pair.
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
Describes the sequence number of the i-th base in the base pair.
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
Describes the PDB insertion code of the j-th base in the base pair.
This data item is a pointer to attribute pdbx_PDB_ins_code in category atom_site in the
ATOM_SITE category.
Describes the asym id of the j-th base in the base pair.
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
Describes the sequence number of the j-th base in the base pair.
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
The value of the base pair opening parameter.
Text label for this base pair.
Sequential number of pair in the pair sequence.
The value of the base pair propeller parameter.
The value of the base pair shear parameter.
The value of the base pair stagger parameter.
The value of the base pair stretch parameter.
Describes the model number of the the base pair.
This data item is a pointer to attribute ndb_model in category atom_site in the
ATOM_SITE category.
Describes the component id of the i-th base in the base pair.
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
Describes the asym id of the i-th base in the base pair.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
Describes the sequence number of the i-th base in the base pair.
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
Describes the symmetry operation that should be applied to the
coordinates of the i-th base to generate the first partner
in the base pair.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
Describes the component id of the j-th base in the base pair.
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
Describes the asym id of the j-th base in the base pair.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
Describes the sequence number of the j-th base in the base pair.
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
Describes the symmetry operation that should be applied to the
coordinates of the j-th base to generate the second partner
in the base pair.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
Data items in the NDB_STRUCT_NA_BASE_PAIR_STEP category record details
of base pair step interactions.
<PDBx:ndb_struct_na_base_pair_stepCategory>
<PDBx:ndb_struct_na_base_pair_step model_number="1" i_label_comp_id_1="G" i_label_asym_id_1="A" i_label_seq_id_1="1" i_symmetry_1="1_555" j_label_comp_id_1="C" j_label_asym_id_1="A" j_label_seq_id_1="8" j_symmetry_1="7_555" i_label_comp_id_2="G" i_label_asym_id_2="A" i_label_seq_id_2="2" i_symmetry_2="1_555" j_label_comp_id_2="C" j_label_asym_id_2="A" j_label_seq_id_2="7" j_symmetry_2="7_555">
<PDBx:shift>0.369</PDBx:shift>
<PDBx:slide>-1.414</PDBx:slide>
<PDBx:rise>3.339</PDBx:rise>
<PDBx:tilt>3.056</PDBx:tilt>
<PDBx:roll>9.755</PDBx:roll>
<PDBx:twist>33.530</PDBx:twist>
</PDBx:ndb_struct_na_base_pair_step>
<PDBx:ndb_struct_na_base_pair_step model_number="1" i_label_comp_id_1="G" i_label_asym_id_1="A" i_label_seq_id_1="2" i_symmetry_1="1_555" j_label_comp_id_1="C" j_label_asym_id_1="A" j_label_seq_id_1="7" j_symmetry_1="7_555" i_label_comp_id_2="G" i_label_asym_id_2="A" i_label_seq_id_2="3" i_symmetry_2="1_555" j_label_comp_id_2="C" j_label_asym_id_2="A" j_label_seq_id_2="6" j_symmetry_2="7_555">
<PDBx:shift>0.176</PDBx:shift>
<PDBx:slide>-1.672</PDBx:slide>
<PDBx:rise>3.371</PDBx:rise>
<PDBx:tilt>-1.176</PDBx:tilt>
<PDBx:roll>6.725</PDBx:roll>
<PDBx:twist>30.004</PDBx:twist>
</PDBx:ndb_struct_na_base_pair_step>
</PDBx:ndb_struct_na_base_pair_stepCategory>
The value of the base pair step helical rise parameter.
The value of the base pair step helical twist parameter.
Describes the PDB insertion code of the i-th base in the
first base pair of the step.
This data item is a pointer to attribute pdbx_PDB_ins_code in category atom_site in
the ATOM_SITE category.
Describes the PDB insertion code of the i-th base in the
second base pair of the step.
This data item is a pointer to attribute pdbx_PDB_ins_code in category atom_site in
the ATOM_SITE category.
Describes the author's asym id of the i-th base in the first
base pair of the step.
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
Describes the author's asym id of the i-th base in the second
base pair of the step.
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
Describes the author's sequence number of the i-th base in the
first base pair of the step.
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
Describes the author's sequence number of the i-th base in the
second base pair of the step.
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
The value of the base pair step inclination parameter.
Describes the PDB insertion code of the j-th base in the
first base pair of the step.
This data item is a pointer to attribute pdbx_PDB_ins_code in category atom_site in
the ATOM_SITE category.
Describes the PDB insertion code of the j-th base in the
second base pair of the step.
This data item is a pointer to attribute pdbx_PDB_ins_code in category atom_site in
the ATOM_SITE category.
Describes the author's asym id of the j-th base in the first
base pair of the step.
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
Describes the author's asym id of the j-th base in the second
base pair of the step.
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
Describes the author's sequence number of the j-th base in the
first base pair of the step.
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
Describes the author's sequence number of the j-th base in the
second base pair of the step.
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
The value of the base pair step rise parameter.
The value of the base pair step roll parameter.
The value of the base pair step shift parameter.
The value of the base pair step slide parameter.
The text name of this step.
The sequence number of this step in the step sequence.
The value of the base pair step tilt parameter.
The value of the base pair step twist parameter.
The value of the base pair step twist parameter.
The value of the base pair step X displacement parameter.
The value of the base pair step Y displacement parameter.
Describes the model number of the the base pair step.
This data item is a pointer to attribute ndb_model in category atom_site in the
ATOM_SITE category.
Describes the component id of the i-th base in the first base pair
of the step.
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
Describes the asym id of the i-th base in the first base pair
of the step.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
Describes the sequence number of the i-th base in the first base pair
of the step.
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
Describes the symmetry operation that should be applied to the
coordinates of the i-th base to generate the first partner
in the first base pair of the step.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
Describes the component id of the j-th base in the first base pair
of the step.
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
Describes the asym id of the j-th base in the first base pair
of the step.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
Describes the sequence number of the j-th base in the first base pair
of the step.
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
Describes the symmetry operation that should be applied to the
coordinates of the j-th base to generate the second partner
in the first base pair of the step.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
Describes the component id of the i-th base in the second base pair
of the step.
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
Describes the asym id of the i-th base in the second base pair
of the step.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
Describes the sequence number of the i-th base in the second base pair
of the step.
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
Describes the symmetry operation that should be applied to the
coordinates of the i-th base to generate the first partner
in the second base pair of the step.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
Describes the component id of the j-th base in the second base pair
of the step.
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
Describes the asym id of the j-th base in the second base pair
of the step.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
Describes the sequence number of the j-th base in the second base pair
of the step.
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
Describes the symmetry operation that should be applied to the
coordinates of the j-th base to generate the second partner
in the second base pair of the step.
no symmetry or translation to site
4th symmetry operation applied
4
7th symm. posn.; +a on x; -b on y
7_645
The PDBX_AUDIT holds current version information.
The value of attribute entry_id in category pdbx_audit identifies the data block.
1
The value of attribute entry_id in category pdbx_audit identifies the data block.
BDL001
Data items in the PDBX_AUDIT_AUTHOR category record details about
the author(s) of the data block.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:pdbx_audit_authorCategory>
<PDBx:pdbx_audit_author ordinal="1">
<PDBx:name>Fitzgerald, Paula M.D.</PDBx:name>
<PDBx:address> Department of Biophysical Chemistry
Merck Research Laboratories
P. O. Box 2000, Ry80M203
Rahway, New Jersey 07065
USA</PDBx:address>
</PDBx:pdbx_audit_author>
<PDBx:pdbx_audit_author ordinal="2">
<PDBx:name>McKeever, Brian M.</PDBx:name>
<PDBx:address> Department of Biophysical Chemistry
Merck Research Laboratories
P. O. Box 2000, Ry80M203
Rahway, New Jersey 07065
USA</PDBx:address>
</PDBx:pdbx_audit_author>
<PDBx:pdbx_audit_author ordinal="3">
<PDBx:name>Van Middlesworth, J.F.</PDBx:name>
<PDBx:address> Department of Biophysical Chemistry
Merck Research Laboratories
P. O. Box 2000, Ry80M203
Rahway, New Jersey 07065
USA</PDBx:address>
</PDBx:pdbx_audit_author>
<PDBx:pdbx_audit_author ordinal="4">
<PDBx:name>Springer, James P.</PDBx:name>
<PDBx:address> Department of Biophysical Chemistry
Merck Research Laboratories
P. O. Box 2000, Ry80M203
Rahway, New Jersey 07065
USA</PDBx:address>
</PDBx:pdbx_audit_author>
</PDBx:pdbx_audit_authorCategory>
The address of an author of this data block. If there are
multiple authors, attribute address in category pdbx_audit_author is looped with
attribute name in category pdbx_audit_author.
Department
Institute
Street
City and postcode
COUNTRY
The name of an author of this data block. If there are multiple
authors, _pdbx_audit_author.name is looped with _pdbx_audit_author.address.
The family name(s), followed by a comma and including any
dynastic compoents, precedes the first name(s) or initial(s).
Bleary, Percival R.
O'Neil, F.K.
Van den Bossche, G.
Yang, D.-L.
Simonov, Yu.A
A unique sequential integer identifier for each author.
1
2
3
Data items in the PDBX_BUFFER category
record details of the sample buffer.
Any additional details to do with buffer.
aerated
The name of each buffer.
Acetic acid
The value of attribute id in category pdbx_buffer must
uniquely identify the sample buffer.
Constituents of buffer in sample
Example 1 - based on PDB entry 1DYL and laboratory records for the
structure corresponding to PDB entry 1DYL
<PDBx:pdbx_buffer_componentsCategory>
<PDBx:pdbx_buffer_components buffer_id="1" id="1">
<PDBx:name>NaCl</PDBx:name>
<PDBx:volume>0.200 </PDBx:volume>
<PDBx:conc>4 </PDBx:conc>
</PDBx:pdbx_buffer_components>
<PDBx:pdbx_buffer_components buffer_id="1" id="2">
<PDBx:name>Acetic Acid</PDBx:name>
<PDBx:volume>0.047 </PDBx:volume>
<PDBx:conc>100</PDBx:conc>
</PDBx:pdbx_buffer_components>
<PDBx:pdbx_buffer_components buffer_id="1" id="3">
<PDBx:name>water</PDBx:name>
<PDBx:volume>0.700 </PDBx:volume>
<PDBx:conc>neat</PDBx:conc>
</PDBx:pdbx_buffer_components>
</PDBx:pdbx_buffer_componentsCategory>
The millimolar concentration of buffer component.
200
The concentration units of the component.
mg/mL for mg per milliliter
mM for millimolar
% for percent by volume
Any additional details to do with buffer composition.
pH adjusted with NaOH
The isotopic composition of each component, including
the % labeling level, if known. For example:
1. Uniform (random) labeling with 15N: U-15N
2. Uniform (random) labeling with 13C, 15N at known labeling
levels: U-95% 13C;U-98% 15N
3. Residue selective labeling: U-95% 15N-Thymine
4. Site specific labeling: 95% 13C-Ala18,
5. Natural abundance labeling in an otherwise uniformly labled
biomolecule is designated by NA: U-13C; NA-K,H
The name of each buffer component.
Acetic acid
The volume of buffer component.
0.200
This data item is a pointer to attribute id in category pdbx_buffer in the BUFFER category.
The value of attribute id in category pdbx_buffer_components must
uniquely identify a component of the buffer.
Data items in the PDBX_CONSTRUCT category specify a sequence of
nucleic acids or amino acids. It is a catch-all that may be used to
provide details of sequences known to be relevant to the project as well
as primers, plasmids, proteins and such like that are either used or
produced during the protein production process. Molecules described
here are not necessarily complete, so for instance it would be
possible to include either a complete plasmid or just its insert.
This category may be considered as an abbreviated form of _entity where
the molecules described are not required to appear in the final co-ordinates.
Note that the details provided here all pertain to a single entry as defined
at deposition. It is anticipated that attribute id in category pdbx_construct would also be
composed of a sequence that is unique within a given site prefixed by a code
that identifies that site and would, therefore, be GLOBALLY unique. Thus
this category could also be used locally to store details about the different
constructs used during protein production without reference to the entry_id
(which only becomes a meaningful concept during deposition).
Example 1 - hypothetical example
<PDBx:pdbx_constructCategory>
<PDBx:pdbx_construct id="1">
<PDBx:entry_id>111000111</PDBx:entry_id>
<PDBx:type>DNA</PDBx:type>
<PDBx:entity_id>1</PDBx:entity_id>
<PDBx:seq> gatgctgtag gcataggctt ggttatgccg gtactgccgg gcctcttgcg ggatatcgtc
gctcaaggcg cactcccgtt ctggataatg ttttttgcgc cgacatcata acggttctgg
caaatattct gaaatgagct gttgacaatt aatcatcgat aagcttcttg
# - - - - data truncated for brevity - - - -</PDBx:seq>
</PDBx:pdbx_construct>
</PDBx:pdbx_constructCategory>
The primary function of the construct. This should be considered
as a guideline only.
The date that the sequence was determined.
2003-12-25
2003-12-25:09:00
Additional details about the construct that cannot be
represented in the category attribute in category pdbx_construct_feature.
In cases where the construct IS found in the co-ordinates then this
item provides a pointer to attribute id in category entity in the ENTITY category for
the corresponding molecule.
The value of attribute entry_id in category pdbx_construct uniquely identifies
a sample consisting of one or more proteins whose structure is
to be determined. This is a pointer to attribute id in category entry. This item may
be a site dependent bar code.
attribute name in category pdbx_construct provides a placeholder for the local name
of the construct, for example the plasmid name if this category
is used to list plasmids.
attribute organisation in category pdbx_construct describes the organisation in which
the attribute id in category pdbx_construct is unique. This will normally be the lab
in which the constrcut originated. It is envisaged that this item
will permit a globally unique identifier to be constructed in cases
where this is not possible from the attribute id in category pdbx_construct alone.
In cases where the sequence has been determined by a robot this
data item provides a pointer to pdbx_robot_system.id in the
PDBX_ROBOT_SYSTEM category for the robot responsible
sequence expressed as string of one-letter base codes or one
letter amino acid codes. Unusual residues may be represented
either using the appropriate one letter code wild cards or
by the three letter code in parentheses.
gatgctgtag gcataggctt ggttatgccg gtactgccgg gcctcttgcg ggatatcgtc
gctcaaggcg cactcccgtt ctggataatg ttttttgcgc cgacatcata acggttctgg
caaatattct gaaatgagct gttgacaatt aatcatcgat aagcttcttg
The type of nucleic acid sequence in the construct. Note that
to find all the DNA molecules it is necessary to search for
DNA + cDNA and for RNA, RNA + mRNA + tRNA.
The value of attribute id in category pdbx_construct must uniquely identify a record
in the PDBX_CONSTRUCT list and should be arranged so that it is
composed of a site-speicific prefix combined with a value that is
unique within a given site.Note that this item need not be a
number; it can be any unique identifier.
Data items in the PDBX_CONSTRUCT_FEATURE category may be used to
specify various properties of a nucleic acid sequence used during
protein production.
Example 1 - vector pUC28
<PDBx:pdbx_construct_featureCategory>
<PDBx:pdbx_construct_feature id="1" construct_id="1">
<PDBx:entry_id>111000111</PDBx:entry_id>
<PDBx:details>pKK84-1 ClaI 5260bp 5247..5247 ptac11 TaqI-TaqI 192bp, -35 trp promoter -> pEA300 5452bp</PDBx:details>
</PDBx:pdbx_construct_feature>
<PDBx:pdbx_construct_feature id="2" construct_id="1">
<PDBx:entry_id>111000111</PDBx:entry_id>
<PDBx:details>pKK84-1 1..5246 5246bp ClaI = AT^CGAT TaqI = T^CGA cgact...</PDBx:details>
</PDBx:pdbx_construct_feature>
<PDBx:pdbx_construct_feature id="3" construct_id="1">
<PDBx:entry_id>111000111</PDBx:entry_id>
<PDBx:start_seq>5247</PDBx:start_seq>
<PDBx:end_seq>5436</PDBx:end_seq>
<PDBx:details>ptac11 190bp ...cat TaqI = T^CGA ClaI = AT^CGAT</PDBx:details>
</PDBx:pdbx_construct_feature>
<PDBx:pdbx_construct_feature id="4" construct_id="1">
<PDBx:entry_id>111000111</PDBx:entry_id>
<PDBx:start_seq>5437</PDBx:start_seq>
<PDBx:end_seq>5450</PDBx:end_seq>
<PDBx:details>pKK84-1 5247..5260 14bp</PDBx:details>
</PDBx:pdbx_construct_feature>
<PDBx:pdbx_construct_feature id="5" construct_id="1">
<PDBx:entry_id>111000111</PDBx:entry_id>
<PDBx:type>misc_binding</PDBx:type>
<PDBx:details>SIT unique EcoRI-ClaI-HindIII-BamHI-PvuII</PDBx:details>
</PDBx:pdbx_construct_feature>
<PDBx:pdbx_construct_feature id="6" construct_id="1">
<PDBx:entry_id>111000111</PDBx:entry_id>
<PDBx:type>rep_origin</PDBx:type>
<PDBx:details>ORI E. coli pMB1 (ColE1 and pBR322)</PDBx:details>
</PDBx:pdbx_construct_feature>
<PDBx:pdbx_construct_feature id="7" construct_id="1">
<PDBx:entry_id>111000111</PDBx:entry_id>
<PDBx:type>promoter</PDBx:type>
<PDBx:details>PRO E. coli trp</PDBx:details>
</PDBx:pdbx_construct_feature>
<PDBx:pdbx_construct_feature id="8" construct_id="1">
<PDBx:entry_id>111000111</PDBx:entry_id>
<PDBx:type>CDS</PDBx:type>
<PDBx:details>ANT E. coli beta-lactamase gene (bla) ampicillin resistance gene (apr/amp)</PDBx:details>
</PDBx:pdbx_construct_feature>
</PDBx:pdbx_construct_featureCategory>
Details that describe the feature
The sequence position at which the feature ends
The value of attribute entry_id in category pdbx_construct_feature uniquely identifies
a sample consisting of one or more proteins whose structure is
to be determined. This is a pointer to attribute id in category entry. This item may
be a site dependent bar code.
The sequence position at which the feature begins
The type of the feature
The value of attribute construct_id in category pdbx_construct_feature uniquely
identifies the construct with which the feature is
associated. This is a pointer to attribute id
in category pdbx_construct This item may be a site dependent bar code.
The value of attribute id in category pdbx_construct_feature must uniquely
identify a record in the PDBX_CONSTRUCT_FEATURE list.
Note that this item need not be a number; it can be any unique
identifier.
The PDBX_DATABASE_PDB_OBS_SPR category provides placeholders
for information on obsolete/superseded PDB entries
The date of replacement.
1997-03-30
Identifier for the type of obsolete entry to be added to this entry.
OBSLTE
The new PDB identifier for the replaced entry.
2ABC
The PDB identifier for the replaced (OLD) entry.
3ABC
The PDBX_DATABASE_MESSAGE category provides information about
correspondance related to a structure deposition.
This code defines the content of the message.
This is the date when a message was sent or received.
The text of the message.
Defines how the message was sent or received.
The name of the receiver.
The email address of the receiver.
The FAX phone number of the receiver.
The postal address of the receiver.
The phone number of the receiver.
The name of the sender.
The email address of the sender.
The FAX phone number of the sender.
The postal address of the sender.
The phone number of the sender.
This is an unique and sequential identifier for a message.
message 1
The value of attribute entry_id in category pdbx_database_message identifies the data block.
BDL001
Internal records to track the data processing cycle.
<PDBx:pdbx_database_procCategory>
<PDBx:pdbx_database_proc entry_id="BDL001" cycle_id="1">
<PDBx:date_begin_cycle>1998-02-27</PDBx:date_begin_cycle>
<PDBx:date_end_cycle>1998-02-27</PDBx:date_end_cycle>
</PDBx:pdbx_database_proc>
</PDBx:pdbx_database_procCategory>
This is the date of the start of the processing cycle.
1983-02-27
This is the date of the end of the processing cycle.
1983-02-27
Special details about the current processing cycle.
This is a number of the processing cycle.
1 for the initial cycle
The value of attribute entry_id in category pdbx_database_proc identifies the data block.
BDL001
Data items in PDBX_DATABASE_RELATED contain references to entries
that are related to the this entry.
<PDBx:pdbx_database_relatedCategory>
<PDBx:pdbx_database_related db_name="PDB" db_id="1ABC"></PDBx:pdbx_database_related>
</PDBx:pdbx_database_relatedCategory>
The identifying content type of the related entry.
minimized average structure
representative structure
ensemble
derivative structure
native structure
other
A description of the related entry.
1ABC contains the same protein complexed with Netropsin.
The name of the database containing the related entry.
PDB - Protein Databank
NDB - Nucleic Acid Database
BMRB - BioMagResBank
BMCD - Biological Macromolecule Crystallization Database
The identifying code in the related database.
1ABC
BDL001
Data items in the PDBX_DATABASE_REMARK category record keep additional
information about the entry. They are mostly used to create
'non-standard' PDB REMARK annotations (6-99).
Example 1 - based on PDB entry 1ABC
<PDBx:pdbx_database_remarkCategory>
<PDBx:pdbx_database_remark id="1">
<PDBx:text> THE NON-CRYSTALLOGRAPHIC RELATIONSHIP BETWEEN THE THREE
DOUBLE HELICES IN THE ASYMMETRIC UNIT IS DESCRIBED
IN THE MTRIX1-3 RECORDS.</PDBx:text>
</PDBx:pdbx_database_remark>
</PDBx:pdbx_database_remarkCategory>
The full text of the PDB remark record.
A unique identifier for the PDB remark record.
These are internal RCSB records to keep track of data processing
and status of the entry.
<PDBx:pdbx_database_statusCategory>
<PDBx:pdbx_database_status entry_id="1ABC">
<PDBx:status_code>REL</PDBx:status_code>
<PDBx:author_release_status_code>REL</PDBx:author_release_status_code>
<PDBx:deposit_site>RCSB</PDBx:deposit_site>
<PDBx:process_site>RCSB</PDBx:process_site>
<PDBx:recvd_initial_deposition_date>1996-02-13</PDBx:recvd_initial_deposition_date>
<PDBx:date_author_approval>1996-02-13</PDBx:date_author_approval>
<PDBx:recvd_author_approval>Y</PDBx:recvd_author_approval>
<PDBx:author_approval_type>explicit</PDBx:author_approval_type>
<PDBx:hold_for_publication>N</PDBx:hold_for_publication>
<PDBx:date_hold_coordinates>1996-02-13</PDBx:date_hold_coordinates>
<PDBx:date_hold_struct_fact>1996-02-13</PDBx:date_hold_struct_fact>
<PDBx:date_of_PDB_release>1996-02-14</PDBx:date_of_PDB_release>
<PDBx:date_deposition_form>1996-02-13</PDBx:date_deposition_form>
<PDBx:date_coordinates>1996-02-13</PDBx:date_coordinates>
<PDBx:date_struct_fact>1996-02-13</PDBx:date_struct_fact>
<PDBx:date_manuscript>1996-02-13</PDBx:date_manuscript>
<PDBx:recvd_deposit_form>Y</PDBx:recvd_deposit_form>
<PDBx:recvd_coordinates>Y</PDBx:recvd_coordinates>
<PDBx:recvd_struct_fact>Y</PDBx:recvd_struct_fact>
<PDBx:recvd_manuscript>Y</PDBx:recvd_manuscript>
<PDBx:recvd_nmr_constraints>N</PDBx:recvd_nmr_constraints>
</PDBx:pdbx_database_status>
</PDBx:pdbx_database_statusCategory>
This code indicates whether the author's approval for
an entry was received explicitly or implicitly. The
latter is automatically implied by failure to respond
to the validation summary within the prescribed period.
implicit = automatic approval by failure to acknowledge
explicit = approval via depositor acknowledgement
The release status authorized by the depositor.
REL = Release
HOLD = On hold until yyyy-mm-dd
HPUB = On hold until publication
OBS = Entry has been obsoleted and replaced by another entry
WDRN = Entry has been withdrawn by depositor
The date the author's approval is received.
1983-02-20
The date the coordinates are received.
1983-02-21
The date the deposition form is received.
1982-02-21
At an author's request, a coordinate entry may be held after
processing for some period of time.
1983-02-28
At an author's request, the NMR constraint data may be held after
processing for some period of time.
1983-02-28
At an author's request, the structure factors may be held after
processing for some period of time.
1983-02-28
The date the manuscript is received.
1983-02-28
The date the structure factors are received.
1983-02-28
PDB release date. This is the date that appears in the PDB
REVDAT record.
1983-02-28
The date the structure factors are received.
1983-02-28
The date of complete deposition. This corresponds to the date
at which the PDB identifier is assigned.
1983-02-20
The deposited coordinates for this deposition will be released according
the value of this item.
RELEASE NOW = Release immediately
HOLD FOR PUBLICATION = Hold until the primary citation is published
HOLD FOR 6 MONTHS = Hold for 6 months
HOLD FOR 1 YEAR = Hold for 1 year
The deposited NMR constrait data for this deposition will be released according
the value of this item.
RELEASE NOW = Release immediately
HOLD FOR PUBLICATION = Hold until the primary citation is published
HOLD FOR 6 MONTHS = Hold for 6 months
HOLD FOR 1 YEAR = Hold for 1 year
The sequence information for this deposition will be released according
the value of this item. Setting this status code to "RELEASE NOW" indicates
that the macromolecular sequence(s) for this entry may be displayed in PDB
status reports prior to the release of the entry. Setting this status
code to "HOLD FOR RELEASE" conceals the sequence information in PDB status
reports until the coordinate data for this entry are released.
RELEASE NOW = Release sequence information in status reports immediately
HOLD FOR RELEASE = Conceal sequence information in status reports until
coordinate data is release
The deposited structure factors for this deposition will be released according
the value of this item.
RELEASE NOW = Release immediately
HOLD FOR PUBLICATION = Hold until the primary citation is published
HOLD FOR 6 MONTHS = Hold for 6 months
HOLD FOR 1 YEAR = Hold for 1 year
The site where the file was deposited.
NDB
RCSB
PDB
EBI
OSAKA
BNL
At an author's request, an entry is to be held until
publication.
Y
The last name of the depositor to be used in correspondance.
Smith
This is the date when PDB received the author's approval for an
entry which has been processed by NDB. (This is a place holder
for entries processed before Jan. 1, 1996.)
1983-02-27
The site where the file was deposited.
NDB
RCSB
EBI
OSAKA
PDB
PRAGUE
The initials of the annotator processing this entry.
BS
SJ
KB
This code indicates whether the author's approval for
an entry has been received.
Y
This code indicates whether the coordinates for an entry
have been received.
Y
This code indicates whether the deposition form for an entry
has been received.
Y
The date of initial deposition. (The first message for
deposition has been received.)
1983-02-21
This code indicates whether the internal approval for an entry
have been received.
Y
This code indicates whether the manuscript for an entry
has been received.
Y
This code indicates whether the NMR contraint data for an entry
have been received.
Y
This code indicates whether the structure factors for an entry
have been received.
Y
Code for status of file.
REL
HOLD
REV
BIB
The value of attribute entry_id in category pdbx_database_status identifies the data block.
BDL001
The PDBX_ENTITY_ASSEMBLY category provides a chemical description
of the biological assembly studied in terms of its constituent
entities.
A complex composed of one copy of entities 1 and 2.
<PDBx:pdbx_entity_assemblyCategory>
<PDBx:pdbx_entity_assembly id="1" entity_id="1">
<PDBx:biol_id>1</PDBx:biol_id>
<PDBx:num_copies>1</PDBx:num_copies>
</PDBx:pdbx_entity_assembly>
<PDBx:pdbx_entity_assembly id="1" entity_id="2">
<PDBx:biol_id>1</PDBx:biol_id>
<PDBx:num_copies>1</PDBx:num_copies>
</PDBx:pdbx_entity_assembly>
</PDBx:pdbx_entity_assemblyCategory>
An identifier for the assembly.
The number of copies of this entity in the assembly.
An identifier for the assembly.
An enity identifier. A reference to attribute id in category entity.
The PDBX_ENTITY_NAME records additional name information for
each entity.
Example 1 -
<PDBx:pdbx_entity_nameCategory>
<PDBx:pdbx_entity_name entity_id="1" name="PLASTOCYANIN" name_type="SWS-NAME"></PDBx:pdbx_entity_name>
<PDBx:pdbx_entity_name entity_id="1" name="Electron transport" name_type="SWS-KEYWORD"></PDBx:pdbx_entity_name>
</PDBx:pdbx_entity_nameCategory>
Pointer to attribute id in category entity.
Entity name.
Entity name type.
Example 1 -
This data item is a pointer to attribute id in category chem_comp in the CHEM_COMP category.
A name for the non-polymer entity
This data item is a pointer to attribute id in category entity in the ENTITY category.
This category contains details of protein characterisation. It
refers to the characteristion of the product of a specific
step.
The date of characterisation step.
2003-12-25
2003-12-25:09:00
Any details associated with this method of protein characterisation.
The method used for protein characterisation.
Dynamic light scattering
Mass spectrometry
The result from this method of protein characterisation.
This data item is a pointer to pdbx_robot_system.id
in the PDBX_ROBOT_SYSTEM category.
The value of attribute entry_id in category pdbx_entity_src_gen_character uniquely identifies
a sample consisting of one or more proteins whose structure is
to be determined. This is a pointer to attribute id in category entry. This item may
be a site dependent bar code.
The value of attribute entity_id in category pdbx_entity_src_gen_character uniquely identifies
each protein contained in the project target complex proteins whose
structure is to be determined. This data item is a pointer to attribute id
in category entity in the ENTITY category. This item may be a site dependent bar code.
This item is the unique identifier for the step whose product
has been characterised.
This category contains details for the chromatographic steps used in the
purification of the protein.
The temperature in degrees celsius at which this column was run.
The type of column used in this step.
The volume of the column used in this step.
The date of production step.
2003-12-25
2003-12-25:09:00
This item is a pointer to pdbx_buffer.id in the PDBX_BUFFER category.
The referenced buffer is that with which the protein was eluted.
Details of the elution protocol.
This item is a pointer to pdbx_construct.id in the PDBX_CONSTRUCT
category. The referenced sequence is expected to be the amino
acid sequence of the expressed product after the
chromatography step.
This item is a pointer to pdbx_buffer.id in the PDBX_BUFFER category.
The referenced buffer is that in which the column was equilibrated.
The rate at which the equilibration buffer flowed through the column.
This item unique identifier for the next production step. This allows
a workflow to have multiple entry points leading to a single product.
Details of any post-chromatographic treatment of the protein sample.
This data item is a pointer to pdbx_robot_system.id
in the PDBX_ROBOT_SYSTEM category.
The method used to determine the concentration of the protein solution put
onto the column.
The concentration of the protein solution put onto the column.
Details of the sample preparation prior to running the column.
The volume of protein solution run on the column.
The total volume of all the fractions pooled to give the purified protein
solution.
The method used to determine the yield
The yield in milligrams of protein recovered in the pooled fractions.
The value of attribute entry_id in category pdbx_entity_src_gen_chrom uniquely identifies
a sample consisting of one or more proteins whose structure is
to be determined. This is a pointer to attribute id in category entry. This item may
be a site dependent bar code.
The value of attribute entity_id in category pdbx_entity_src_gen_chrom uniquely identifies
each protein contained in the project target complex proteins whose
structure is to be determined. This data item is a pointer to attribute id
in category entity in the ENTITY category. This item may be a site dependent bar code.
This item is the unique identifier for this chromatography step.
This category contains details for the cloning steps used in
the overall protein production process. Each row in PDBX_ENTITY_SRC_GEN_CLONE
should have an equivalent row in either PDBX_ENTITY_SRC_GEN_CLONE_LIGATION or
PDBX_ENTITY_SRC_GEN_CLONE_RECOMBINATION. If only summary information is
provided data in the later two categories may be omitted.
The date of this production step.
2003-12-25
2003-12-25:09:00
This item is a pointer to pdbx_construct.id in the PDBX_CONSTRUCT
category. The referenced nucleic acid sequence is that of the
cloned product.
The method used to insert the gene into the vector. For 'Ligation', an
PDBX_ENTITY_SRC_GEN_CLONE_LIGATION entry with matching .step_id is expected. For
'Recombination', an PDBX_ENTITY_SRC_GEN_CLONE_RECOMBINATION entry with matching
.step_id is expected.
The type of marker included to allow selection of transformed cells
This item unique identifier for the next production step.
This allows a workflow to have multiple entry points leading
to a single product.
Details of any purification of the product.
This data item is a pointer to pdbx_robot_system.id in the
PDBX_ROBOT_SYSTEM category.
Summary of ligation or recombionation cloning used, the associated
verification method and any purification of the product.
The method used to transform the expression cell line with the vector
Details of any modifications made to the named vector.
The name of the vector used in this cloning step.
The method used to verify that the incorporated gene is correct
The value of attribute entry_id in category pdbx_entity_src_gen_clone uniquely identifies
a sample consisting of one or more proteins whose structure is
to be determined. This is a pointer to attribute id in category entry. This item may
be a site dependent bar code.
The value of attribute entity_id in category pdbx_entity_src_gen_clone uniquely identifies
each protein contained in the project target protein complex whose
structure is to be determined. This data item is a pointer to attribute id
in category entity in the ENTITY category. This item may be a site dependent bar code.
This item is the unique identifier for this cloning step.
This category contains details for the ligation-based cloning steps used in
the overall protein production process.
attribute clone_step_id in category pdbx_entity_src_gen_clone_ligation in this category
must point at a defined attribute step_id in category pdbx_entity_src_gen_clone. The details in
PDBX_ENTITY_SRC_GEN_CLONE_LIGATION extend the details in PDBX_ENTITY_SRC_GEN_CLONE
to cover ligation dependent cloning steps.
The names of the enzymes used to cleave the vector. In addition an enzyme
used to blunt the cut ends, etc., should be named here.
Any details to be associated with this ligation step, e.g. the protocol.
The names of the enzymes used to ligate the gene into the cleaved vector.
The temperature at which the ligation experiment was performed, in degrees
celsius.
The duration of the ligation reaction in minutes.
This item is a pointer to attribute entry_id in category pdbx_entity_src_gen_clone in the
PDBX_ENTITY_SRC_GEN_CLONE category.
This item is a pointer to attribute entity_id in category pdbx_entity_src_gen_clone in the
PDBX_ENTITY_SRC_GEN_CLONE category.
This item is a pointer to attribute step_id in category pdbx_entity_src_gen_clone in the
PDBX_ENTITY_SRC_GEN_CLONE category.
This category contains details for the recombination-based cloning steps
used in the overall protein production process. It is assumed that these
reactions will use commercially available kits.
attribute clone_step_id in category pdbx_entity_src_gen_clone_recombination in this category
must point at a defined attribute step_id in category pdbx_entity_src_gen_clone. The details in
PDBX_ENTITY_SRC_GEN_CLONE_RECOMBINATION extend the details in PDBX_ENTITY_SRC_GEN_CLONE
to cover recombination dependent cloning steps.
Any details to be associated with this recombination step, e.g. the protocol
or differences from the manufacturer's specified protocol.
The names of the enzymes used for this recombination step.
The name of the recombination system.
This item is a pointer to attribute entry_id in category pdbx_entity_src_gen_clone in the
PDBX_ENTITY_SRC_GEN_CLONE category.
This item is a pointer to attribute entity_id in category pdbx_entity_src_gen_clone in the
PDBX_ENTITY_SRC_GEN_CLONE category.
This item is a pointer to attribute step_id in category pdbx_entity_src_gen_clone in the
PDBX_ENTITY_SRC_GEN_CLONE category.
This category contains details for the EXPRESSION steps used in
the overall protein production process. It is hoped that this category
will cover all forms of cell-based expression by reading induction as
induction/transformation/transfection.
Any C-terminal sequence tag as a string of one letter amino acid codes
Any N-terminal sequence tag as a string of one letter amino acid codes.
Any additives to the base media in which the expression host was grown.
The name of the base media in which the expression host was grown.
The temperature in degrees celsius at which the expression host was allowed
to grow prior to induction/transformation/transfection.
The time in hours for which the expression host was allowed to grow
prior to induction/transformation/transfection.
The volume of media in milliliters in which the expression host was grown.
The date of production step.
2003-12-25
2003-12-25:09:00
This item is a pointer to pdbx_construct.id in the PDBX_CONSTRUCT
category. The referenced sequence is expected to be the amino
acid sequence of the expressed product.
Details of the harvesting protocol.
A specific line of cells used as the expression system
The common name of the organism that served as host for the
expression system. Where attribute host_org_tax_id
in category pdbx_entity_src_gen_express is populated it is expected that this item may be derived by
look up against the taxonomy database.
Culture collection of the expression system
A description of special aspects of the organism that served as
host for the expression system.
The scientific name of the organism that served as host for the
expression system. It is expected that either this item or
attribute host_org_tax_id in category pdbx_entity_src_gen_express should be populated.
The strain of the organism that served as host for the expression
system. Where attribute host_org_tax_id in category pdbx_entity_src_gen_express is
populated it is expected that this item may be derived by a
look up against the taxonomy database.
The id for the NCBI taxonomy node corresponding to the organism that
served as host for the expression system.
The specific tissue which expressed the molecule.
The vairant of the organism that served as host for the expression
system. Where attribute host_org_tax_id in category pdbx_entity_src_gen_express is
populated it is expected that this item may be derived by a
look up against the taxonomy database.
The chemical name of the inducing agent.
Concentration of the inducing agent.
Details of induction/transformation/transfection.
The temperature in celsius at which the induced/transformed/transfected
cells were grown.
The time in hours after induction/transformation/transfection at which
the optical density of the culture was measured.
The multiplicity of infection for genes introduced by transfection, eg.
for baculovirus-based expression.
This item unique identifier for the next production step. This allows
a workflow to have multiple entry points leading to a single product.
This item is a pointer to attribute id in category pdbx_construct in the
PDBX_CONSTRUCT category. The referenced entry will contain
the nucleotide sequence that is to be expressed, including tags.
The nature of the promoter controlling expression of the gene.
T7 LacZ
This data item is a pointer to pdbx_robot_system.id
in the PDBX_ROBOT_SYSTEM category.
Details of how the harvested culture was stored.
Summary of the details of the expression steps used in protein production.
Identifies the type of vector used (plasmid, virus, or cosmid)
in the expression system.
The value of attribute entry_id in category pdbx_entity_src_gen_express uniquely identifies
a sample consisting of one or more proteins whose structure is
to be determined. This is a pointer to attribute id in category entry. This item may
be a site dependent bar code.
The value of attribute entity_id in category pdbx_entity_src_gen_express uniquely identifies
each protein contained in the project target complex proteins whose
structure is to be determined. This data item is a pointer to attribute id
in category entity in the ENTITY category.
This item may be a site dependent bar code.
This item is the unique identifier for this expression step.
This category contains details for OD time series used to monitor a
given EXPRESSION step used in the overall protein production process.
The optical density of the expression culture in arbitrary units at the
timepoint specified.
The time in hours after induction/transformation/transfection at which
the optical density of the culture was measured.
The value of attribute entry_id in category pdbx_entity_src_gen_express_timepoint is a pointer
to attribute entry_id in category pdbx_entity_src_gen_express
The value of attribute entity_id in category pdbx_entity_src_gen_express_timepoint is a pointer
to attribute entity_id in category pdbx_entity_src_gen_express
This item is a pointer to attribute step_id in category pdbx_entity_src_gen_express
This items uniquely defines a timepoint within a series.
This category contains details for the fraction steps used in
the overall protein production process. Examples of fractionation
steps are centrifugation and magnetic bead pull-down purification.
The date of this production step.
2003-12-25
2003-12-25:09:00
String value containing details of the fractionation.
This item is a pointer to pdbx_construct.id in the PDBX_CONSTRUCT
category. The referenced sequence is expected to be the amino
acid sequence of the expressed product after the fractionation
step.
This item describes the method of fractionation.
This item unique identifier for the next production step. This allows
a workflow to have multiple entry points leading to a single product.
The fraction containing the protein of interest.
The volume of the fraction containing the protein.
The yield in milligrams of protein from the fractionation.
The method used to determine the yield
This data item is a pointer to pdbx_robot_system.id
in the PDBX_ROBOT_SYSTEM category.
The temperature in degrees celsius at which the fractionation was performed.
The value of attribute entry_id in category pdbx_entity_src_gen_fract uniquely identifies
a sample consisting of one or more proteins whose structure is
to be determined. This is a pointer to attribute id in category entry. This item may
be a site dependent bar code.
The value of attribute entity_id in category pdbx_entity_src_gen_fract uniquely identifies
each protein contained in the project target protein complex whose
structure is to be determined. This data item is a pointer to attribute id
in category entity in the ENTITY category. This item may be a site dependent bar code.
This item is the unique identifier for this fractionation step.
This category contains details for the cell lysis steps used in
the overall protein production process.
This item is a pointer to pdbx_buffer.id in the PDBX_BUFFER category.
The referenced buffer is that in which the lysis was performed.
The volume in milliliters of buffer in which the lysis was performed.
The date of this production step.
2003-12-25
2003-12-25:09:00
String value containing details of the lysis protocol.
This item is a pointer to pdbx_construct.id in the PDBX_CONSTRUCT
category. The referenced sequence is expected to be the amino
acid sequence of the expressed product after lysis.
The lysis method.
This item unique identifier for the next production step. This allows
a workflow to have multiple entry points leading to a single product.
This data item is a pointer to pdbx_robot_system.id
in the PDBX_ROBOT_SYSTEM category.
The temperature in degrees celsius at which the lysis was performed.
The time in seconds of the lysis experiment.
The value of attribute entry_id in category pdbx_entity_src_gen_lysis uniquely identifies
a sample consisting of one or more proteins whose structure is
to be determined. This is a pointer to attribute id in category entry. This item may
be a site dependent bar code.
The value of attribute entity_id in category pdbx_entity_src_gen_lysis uniquely identifies
each protein contained in the project target protein complex whose
structure is to be determined. This data item is a pointer to attribute id
in category entity in the ENTITY category. This item may be a site dependent bar code.
This item is the unique identifier for this lysis step.
This category contains details for the DIGEST steps used in
the overall protein production process. The digestion is assumed
to be applied to the result of the previous production step, or the
gene source if this is the first production step.
Example 1 - hypothetical example
<PDBx:pdbx_entity_src_gen_prod_digestCategory>
<PDBx:pdbx_entity_src_gen_prod_digest entry_id="111000111" entity_id="222000111" step_id="2">
<PDBx:next_step_id>3</PDBx:next_step_id>
<PDBx:end_construct_id>440050000123</PDBx:end_construct_id>
<PDBx:robot_id>5</PDBx:robot_id>
<PDBx:date>2002-07-12:15:13</PDBx:date>
<PDBx:restriction_enzyme_1>NcoI</PDBx:restriction_enzyme_1>
<PDBx:restriction_enzyme_2>BamII</PDBx:restriction_enzyme_2>
<PDBx:purification_details> No purification</PDBx:purification_details>
</PDBx:pdbx_entity_src_gen_prod_digest>
</PDBx:pdbx_entity_src_gen_prod_digestCategory>
The date of this production step.
2003-12-25
This item is a pointer to pdbx_construct.id in the
PDBX_CONSTRUCT category. The referenced nucleic acid sequence
is that of the digest product
This item unique identifier for the next production step. This allows
a workflow to have multiple entry points leading to a single product.
String value containing details of any purification of the
product of the digestion.
The first enzyme used in the restriction digestion. The sites at
which this cuts can be derived from the sequence.
BamIII
The second enzyme used in the restriction digestion. The sites at
which this cuts can be derived from the sequence.
This data item is a pointer to pdbx_robot_system.id
in the PDBX_ROBOT_SYSTEM category.
Summary of the details of restriction digestion any purification of the
product of the digestion.
The value of attribute entry_id in category pdbx_entity_src_gen_prod_digest uniquely identifies
a sample consisting of one or more proteins whose structure is
to be determined. This is a pointer to attribute id in category entry. This item may
be a site dependent bar code.
The value of attribute entity_id in category pdbx_entity_src_gen_prod_digest uniquely identifies
each protein contained in the project target protein complex whose
structure is to be determined. This data item is a pointer to attribute id
in category entity in the ENTITY category. This item may be a site dependent bar code.
This item is the unique identifier for this digestion step.
This category contains details for process steps that are
not explicitly catered for elsewhere. It provides some basic
details as well as placeholders for a list of parameters and
values (the category PDBX_ENTITY_SRC_GEN_PROD_OTHER_PARAMETER).
Note that processes that have been modelled explicitly should
not be represented using this category.
The date of this process step.
2003-12-25
2003-12-25:09:00
Additional details of this process step.
This item is a pointer to pdbx_construct.id in the PDBX_CONSTRUCT
category. The referenced nucleic acid sequence is that of the
product of the process step.
This item unique identifier for the next production step.
This allows a workflow to have multiple entry points leading
to a single product.
Name of this process step.
This data item is a pointer to pdbx_robot_system.id in the
PDBX_ROBOT_SYSTEM category. The referenced robot is the
robot responsible for the process step
The value of attribute entry_id in category pdbx_entity_src_gen_prod_other uniquely identifies
a sample consisting of one or more proteins whose structure is
to be determined. This is a pointer to attribute id in category entry. This item may
be a site dependent bar code.
The value of attribute entity_id in category pdbx_entity_src_gen_prod_other uniquely identifies
each protein contained in the project target protein complex whose
structure is to be determined. This data item is a pointer to attribute id
in category entity in the ENTITY category. This item may be a site dependent bar code.
This item is the unique identifier for this process step.
This category contains parameters and values required to capture
information about a particular process step
Additional details about the parameter
The value of the parameter
The value of attribute entry_id in category pdbx_entity_src_gen_prod_other_parameter is a pointer
to attribute entry.id in category pdbx_entity_src_gen_prod_other
The value of attribute entity_id in category pdbx_entity_src_gen_prod_other_parameter is a pointer
to attribute entity_id in category pdbx_entity_src_gen_prod_other
This item is a pointer to attribute step_id in category pdbx_entity_src_gen_prod_other
The name of the parameter associated with the process step
This category contains details for the PCR steps used in
the overall protein production process. The PCR is assumed
to be applied to the result of the previous production step, or the
gene source if this is the first production step.
Example 1 - hypothetical example
<PDBx:pdbx_entity_src_gen_prod_pcrCategory>
<PDBx:pdbx_entity_src_gen_prod_pcr entry_id="111000111" entity_id="222000111" step_id="1">
<PDBx:next_step_id>2</PDBx:next_step_id>
<PDBx:end_construct_id>440050000111</PDBx:end_construct_id>
<PDBx:robot_id>5</PDBx:robot_id>
<PDBx:date>2002-07-12:15:13</PDBx:date>
<PDBx:forward_primer_id>2</PDBx:forward_primer_id>
<PDBx:reverse_primer_id>3</PDBx:reverse_primer_id>
<PDBx:reaction_details> Annealing temperature = 70 C
Annealing time = 60 s
Extending temperature = 74 C
Extending time = 120 s
Melting temperature = 95 C
Melting time = 120 s
Number of cycles = 40
Polymerase = KOD
Template = 10 pmol
Primer = 25 pmol
Total volume = 25 ul</PDBx:reaction_details>
<PDBx:purification_details> No purification</PDBx:purification_details>
</PDBx:pdbx_entity_src_gen_prod_pcr>
</PDBx:pdbx_entity_src_gen_prod_pcrCategory>
The date of this production step.
2003-12-25
2003-12-25:09:00
This item is a pointer to pdbx_construct.id in the PDBX_CONSTRUCT
category. The referenced nucleic acid sequence is that of the
PCR product.
This item is a pointer to pdbx_construct.id in the PDBX_CONSTRUCT category.
The referenced nucleic acid sequence is that of the forward primer.
This item unique identifier for the next production step.
This allows a workflow to have multiple entry points leading
to a single product.
String value containing details of any purification of the
product of the PCR reaction.
String value containing details of the PCR reaction.
This item is a pointer to pdbx_construct.id in the PDBX_CONSTRUCT category.
The referenced nucleic acid sequence is that of the reverse primer.
This data item is a pointer to pdbx_robot_system.id in the
PDBX_ROBOT_SYSTEM category. The referenced robot is the
robot responsible for the PCR reaction (normally the heat
cycler).
Summary of the details of the PCR reaction any purification of the
product of the PCR reaction.
The value of attribute entry_id in category pdbx_entity_src_gen_prod_pcr uniquely identifies
a sample consisting of one or more proteins whose structure is
to be determined. This is a pointer to attribute id in category entry. This item may
be a site dependent bar code.
The value of attribute entity_id in category pdbx_entity_src_gen_prod_pcr uniquely identifies
each protein contained in the project target protein complex whose
structure is to be determined. This data item is a pointer to attribute id
in category entity in the ENTITY category. This item may be a site dependent bar code.
This item is the unique identifier for this PCR step.
This category contains details for the protein purification
tag removal steps used in the overall protein production process
This item is a pointer to pdbx_buffer.id in the PDBX_BUFFER category.
The referenced buffer is that in which the cleavage was performed.
The temperature in degrees celsius at which the cleavage was performed.
The time in minutes for the cleavage reaction
The date of production step.
2003-12-25
2003-12-25:09:00
Details of this tag removal step.
This item is a pointer to pdbx_construct.id in the PDBX_CONSTRUCT
category. The referenced sequence is expected to be the amino
acid sequence of the expressed product after the proteolysis
step.
This item unique identifier for the next production step. This allows
a workflow to have multiple entry points leading to a single product.
The name of the protease used for cleavage.
The ratio of protein to protease used for the cleavage.
= mol protein / mol protease
This data item is a pointer to pdbx_robot_system.id
in the PDBX_ROBOT_SYSTEM category.
The value of attribute entry_id in category pdbx_entity_src_gen_proteolysis uniquely identifies
a sample consisting of one or more proteins whose structure is
to be determined. This is a pointer to attribute id in category entry. This item may
be a site dependent bar code.
The value of attribute entity_id in category pdbx_entity_src_gen_proteolysis uniquely identifies
each protein contained in the project target complex proteins whose
structure is to be determined. This data item is a pointer to attribute id
in category entity in the ENTITY category. This item may be a site dependent bar code.
This item is the unique identifier for this tag removal step.
This category contains details for the final purified protein product. Note
that this category does not contain the amino acid sequence of the protein.
The sequence will be found in the ENTITY_POLY_SEQ entry with matching
entity_id.
Only one PDBX_ENTITY_SRC_GEN_PURE category is allowed per entity, hence there is
no step_id for this category.
The method used to measure the protein concentration
Details of the protein concentration procedure
This data item is a pointer to pdbx_robot_system.id
in the PDBX_ROBOT_SYSTEM category.
The date of production step.
2003-12-25
2003-12-25:09:00
When present, this item should be a globally unique identifier
that identifies the final product. It is envisaged that this
should be the same as and product code associated with the
sample and would provide the key by which information about
the production process may be extracted from the protein
production facility. For files describing the protein
production process (i.e. where attribute type in category entity is 'P' or 'E')
this should have the same value as attribute id in category entry
The final concentration of the protein.
The oligomeric state of the protein. Monomeric is 1, dimeric 2, etc.
The purity of the protein (percent).
The yield of protein in milligrams.
This item is a pointer to pdbx_buffer.id in the PDBX_BUFFER category.
The referenced buffer is that in which the protein was stored.
The temperature in degrees celsius at which the protein was stored.
Summary of the details of protein purification method used to obtain the final
protein product. This description should include any lysis, fractionation,
proteolysis, refolding, chromatography used as well as the method used the
characterize the final product.
The value of attribute entry_id in category pdbx_entity_src_gen_pure uniquely identifies
a sample consisting of one or more proteins whose structure is
to be determined. This is a pointer to attribute id in category entry. This item may
be a site dependent bar code.
The value of attribute entity_id in category pdbx_entity_src_gen_pure uniquely identifies
each protein contained in the project target complex proteins whose
structure is to be determined. This data item is a pointer to attribute id
in category entity in the ENTITY category. This item may be a site dependent bar code.
This item unique identifier the production step.
This category contains details for the refolding steps used in
the overall protein production process.
The date of this production step.
2003-12-25
2003-12-25:09:00
This item is a pointer to pdbx_buffer.id in the PDBX_BUFFER category.
The referenced buffer is that in which the protein was denatured.
String value containing details of the refolding.
This item is a pointer to pdbx_construct.id in the PDBX_CONSTRUCT
category. The referenced sequence is expected to be the amino
acid sequence of the expressed product after the refolding
step.
This item unique identifier for the next production step. This allows
a workflow to have multiple entry points leading to a single product.
This item is a pointer to pdbx_buffer.id in the PDBX_BUFFER category.
The referenced buffer is that in which the protein was refolded.
This data item is a pointer to pdbx_robot_system.id
in the PDBX_ROBOT_SYSTEM category.
This item is a pointer to pdbx_buffer.id in the PDBX_BUFFER category.
The referenced buffer is that in which the refolded protein was stored.
The temperature in degrees celsius at which the protein was refolded.
The time in hours over which the protein was refolded.
The value of attribute entry_id in category pdbx_entity_src_gen_refold uniquely identifies
a sample consisting of one or more proteins whose structure is
to be determined. This is a pointer to attribute id in category entry. This item may
be a site dependent bar code.
The value of attribute entity_id in category pdbx_entity_src_gen_refold uniquely identifies
each protein contained in the project target protein complex whose
structure is to be determined. This data item is a pointer to attribute id
in category entity in the ENTITY category. This item may be a site dependent bar code.
This item is the unique identifier for this refolding step.
PDBX_ENTITY_SRC_SYN records the details about each chemically
synthesized molecule (entity) in the asymmetric unit.
A description of special aspects of the source for the
synthetic entity.
This sequence occurs naturally in humans.
This data item is a pointer to attribute id in category entity in the ENTITY category.
1
2
3
4
This section provides a tabulation of constraint data.
This example uses the data from the MCP-1 structure determination. Remember
this is a dimer so there are intersubunit constraints as well as intrasubunit
constraints.
<PDBx:pdbx_nmr_constraintsCategory>
<PDBx:pdbx_nmr_constraints entry_id="1ABC">
<PDBx:NOE_constraints_total>4458</PDBx:NOE_constraints_total>
<PDBx:NOE_intraresidue_total_count>1144</PDBx:NOE_intraresidue_total_count>
<PDBx:NOE_sequential_total_count>272</PDBx:NOE_sequential_total_count>
<PDBx:NOE_medium_range_total_count>1004</PDBx:NOE_medium_range_total_count>
<PDBx:NOE_long_range_total_count>1356</PDBx:NOE_long_range_total_count>
<PDBx:protein_phi_angle_constraints_total_count>96</PDBx:protein_phi_angle_constraints_total_count>
</PDBx:pdbx_nmr_constraints>
</PDBx:pdbx_nmr_constraintsCategory>
The total number of nucleic acid alpha-angle constraints used in
the final structure calculation.
18
The total number of nucleic acid beta-angle constraints used in
the final structure calculation.
24
The total number of nucleic acid chi-angle constraints used
in the final structure calculation.
15
The total number of nucleic acid delta-angle constraints used in
the final structure calculation.
15
The total number of nucleic acid epsilon-angle constraints used
in the final structure calculation.
31
The total number of nucleic acid gamma-angle constraints used in
the final structure calculation.
12
The total number of nucleic acid other-angle constraints used
in the final structure calculation.
5
The total number of nucleic acid sugar pucker constraints used
in the final structure calculation.
10
The total number of all NOE constraints used in the final
structure calculation.
4458
The total number of interentity, NOE constraints
used in the final structure calculation. This field should only be
if system is complex -i.e more than one entity e.g. a dimer or ligand-protein
complex
272
Describe the method used to quantify the NOE and ROE values.
NOE buildup curves with 50, 75, 150 ms mixing times were
analyzed.
Noesy cross peak intensities were classified into three different
catagories with distances of 1.8-2.7 A, 1.8-3.5 A, 1.8- 5.0 A for strong,
medium and weak NOEs.
The total number of all intraresidue, [i-j]=0, NOE constraints
used in the final structure calculation.
1144
The total number of long range [i-j]>5 NOE constraints used
in the final structure calculation.
1356
The total number of medium range 1<[i-j]<=5 NOE constraints used
in the final structure calculation.
682
Describe any corrections that were made to the NOE data for motional averaging.
Replace with item example text
Describe any corrections made for pseudoatoms
Pseudo-atoms nomenclature and corrections according to Wuethrich, Billeter,
and Braun, J. Mol.Biol.(1983) 169, 949-961.
Pseudoatoms were not used.
The total number of sequential, [i-j]=1, NOE constraints used
in the final structure calculation.
1004
The total number of disulfide bond constraints used in the final
structure calculation.
3
The total number of hydrogen bond constraints used in the final
structure calculation.
6
The total number of chi angle constraints used in the final structure
calculation.
66
The total number of other angle constraints used in the final structure
calculation.
0
The total number of phi angle constraints used in the final structure
calculation
96
The total number of psi angle constraints used in the final structure
calculation.
0
You can leave this blank as an ID will be assigned by the MSD
to the constraint file.
Experimental details of the NMR study that have not been
described elsewhere in this deposition.
Additional details describing the NMR experiment.
This structure was determined using standard 2D homonuclear techniques.
The structure was determined using triple-resonance NMR spectroscopy.
The entry ID for the structure determination.
This category contains the information that describes the
ensemble of deposited structures. If only an average structure
has been deposited skip this section.
This example uses the data from the MCP-1 study.
<PDBx:pdbx_nmr_ensembleCategory>
<PDBx:pdbx_nmr_ensemble entry_id="1ABC">
<PDBx:conformers_calculated_total_number>40</PDBx:conformers_calculated_total_number>
<PDBx:conformers_submitted_total_number>20</PDBx:conformers_submitted_total_number>
<PDBx:conformer_selection_criteria>structures with the least restraint violations</PDBx:conformer_selection_criteria>
<PDBx:representative_conformer>1</PDBx:representative_conformer>
</PDBx:pdbx_nmr_ensemble>
</PDBx:pdbx_nmr_ensembleCategory>
The average number of constraint violations on a per residue basis for
the ensemble.
0.25
The average number of constraints per residue for the ensemble
30.2
The average distance restraint violation for the ensemble.
0.11
The average torsion angle constraint violation for the ensemble.
2.4
By highlighting the appropriate choice(s), describe how the submitted
conformer (models) were selected.
structures with the lowest energy
structures with the least restraint violations
structures with acceptable covalent geometry
structures with favorable non-bond energy
target function
back calculated data agree with experimental NOESY spectrum
all calculated structures submitted
The submitted conformer models are the 25 structures with the lowest
energy.
The submitted conformer models are those with the fewest number of
constraint violations.
The total number of conformer (models) that were calculated in the final round.
40
The number of conformer (models) that are submitted for the ensemble.
20
Describe the method used to calculate the distance constraint violation statistics,
i.e. are they calculated over all the distance constraints or calculated for
violations only?
Statistics were calculated over all of the distance constraints.
Statistics were calculated for violations only
The maximum distance constraint violation for the ensemble.
0.4
The maximum lower distance constraint violation for the ensemble.
0.3
The maximum torsion angle constraint violation for the ensemble.
4
The maximum upper distance constraint violation for the ensemble.
0.4
The number of the conformer identified as most representative.
20
This item describes the method used to calculate the torsion angle constraint violation statistics.
i.e. are the entered values based on all torsion angle or calculated for violations only?
Statistics were calculated over all the torsion angle constraints.
Statistics were calculated for torsion angle constraints violations only.
Leave this blank as the ID is provided by the MSD
Structural statistics are derived from molecular dynamics and simulated annealing
programs.
This example is derived from the MCP-1 structure calculation statistics.
For this structure the statistics were calculated over residues 5-69 for
both the monomer and dimer .
<PDBx:pdbx_nmr_ensemble_rmsCategory>
<PDBx:pdbx_nmr_ensemble_rms entry_id="1ABC">
<PDBx:residue_range_begin>5</PDBx:residue_range_begin>
<PDBx:chain_range_begin>A</PDBx:chain_range_begin>
<PDBx:residue_range_end>69</PDBx:residue_range_end>
<PDBx:chain_range_end>A</PDBx:chain_range_end>
<PDBx:atom_type>all heavy atoms</PDBx:atom_type>
<PDBx:distance_rms_dev>0.22</PDBx:distance_rms_dev>
<PDBx:distance_rms_dev_error>0.06</PDBx:distance_rms_dev_error>
</PDBx:pdbx_nmr_ensemble_rms>
</PDBx:pdbx_nmr_ensemble_rmsCategory>
Statistics are often calculated over only some of the atoms,
e.g. backbone, or heavy atoms. Describe which type of atoms are used for
the statistical analysis.
backbone atoms
heavy atoms
The bond angle rmsd to the target values for the ensemble.
0.60
The error in the bond angle rmsd.
0.01
The beginning chain id.
A
The ending chain id:
A
Describe the method for calculating the coordinate average rmsd.
Replace with item example text
The covalent bond rmsd to the target value for the ensemble.
0.0066
The error in the covalent bond rmsd.
0.0001
The dihedral angle rmsd to the target values for the ensemble.
0.66
The error of the rmsd dihedral angles.
0.07
The distance rmsd to the mean structure for the ensemble of structures.
0.22
The error in the distance rmsd.
0.07
The improper torsion angle rmsd to the target values for the ensemble.
0.64
The error in the improper torsion angle rmsd.
0.04
The peptide planarity rmsd.
0.11
The error in the peptide planarity rmsd.
0.05
Structure statistics are often calculated only over the well-ordered region(s)
of the biopolymer. Portions of the macromolecule are often mobile and
disordered, hence they are excluded in calculating the statistics. To define
the range(s) over which the statistics are calculated, enter the beginning
residue number(s): e.g. if the regions used were 5-32 and 41-69, enter 5,41
5
41
The ending residue number: e.g. 32,69.
32
69
'?'
In this section, enter information on those experiments that were
used to generate constraint data. For each NMR experiment indicate
which sample and which sample conditions were used for the experiment.
This example was taken from the MCP-1 study.
<PDBx:pdbx_nmr_exptlCategory>
<PDBx:pdbx_nmr_exptl experiment_id="1" solution_id="3" conditions_id="1">
<PDBx:type>3D_15N-separated_NOESY</PDBx:type>
</PDBx:pdbx_nmr_exptl>
<PDBx:pdbx_nmr_exptl experiment_id="2" solution_id="1" conditions_id="1">
<PDBx:type>3D_13C-separated_NOESY</PDBx:type>
</PDBx:pdbx_nmr_exptl>
<PDBx:pdbx_nmr_exptl experiment_id="3" solution_id="1" conditions_id="2">
<PDBx:type>4D_13C/15N-separated_NOESY</PDBx:type>
</PDBx:pdbx_nmr_exptl>
<PDBx:pdbx_nmr_exptl experiment_id="4" solution_id="1" conditions_id="1">
<PDBx:type>4D_13C-separated_NOESY</PDBx:type>
</PDBx:pdbx_nmr_exptl>
<PDBx:pdbx_nmr_exptl experiment_id="5" solution_id="1" conditions_id="1">
<PDBx:type>3D_15N-separated_ROESY</PDBx:type>
</PDBx:pdbx_nmr_exptl>
<PDBx:pdbx_nmr_exptl experiment_id="6" solution_id="3" conditions_id="1">
<PDBx:type>3D_13C-separated_ROESY</PDBx:type>
</PDBx:pdbx_nmr_exptl>
</PDBx:pdbx_nmr_exptlCategory>
The type of NMR experiment.
2D NOESY
3D_15N-separated_NOESY
3D_13C-separated_NOESY
4D_13C-separated_NOESY
4D_13C/15N-separated_NOESY
3D_15N-separated_ROESY
3D_13C-separated_ROESY
HNCA-J
HNHA
DQF-COSY
P-COSY
PE-COSY
E-COSY
A numerical ID for each experiment.
1
2
3
The number to identify the set of sample conditions.
1
2
3
The solution_id from the Experimental Sample to identify the sample
that these conditions refer to.
[Remember to save the entries here before returning to the
Experimental Sample form]
1
2
3
The chemical constituents of
each NMR sample. Each sample is identified by a number and
each component in the sample is identified by name.
Example 1
This example was taken from the study of MCP-1 which is a dimer under the
conditions studied. Three solutions with different isotope compositions were
studied.
<PDBx:pdbx_nmr_exptl_sampleCategory>
<PDBx:pdbx_nmr_exptl_sample solution_id="1" component="MCP-1">
<PDBx:concentration>2</PDBx:concentration>
<PDBx:concentration_units>mM</PDBx:concentration_units>
<PDBx:isotopic_labeling>U-15N,13C</PDBx:isotopic_labeling>
</PDBx:pdbx_nmr_exptl_sample>
<PDBx:pdbx_nmr_exptl_sample solution_id="1" component="H2O">
<PDBx:concentration>90</PDBx:concentration>
<PDBx:concentration_units>%</PDBx:concentration_units>
</PDBx:pdbx_nmr_exptl_sample>
<PDBx:pdbx_nmr_exptl_sample solution_id="1" component="D2O">
<PDBx:concentration>10</PDBx:concentration>
<PDBx:concentration_units>%</PDBx:concentration_units>
</PDBx:pdbx_nmr_exptl_sample>
</PDBx:pdbx_nmr_exptl_sampleCategory>
Example 2
This example was taken from the study of MCP-1 which is a dimer under the
conditions studied. Three solutions with different isotope compositions were
studied.
<PDBx:pdbx_nmr_exptl_sampleCategory>
<PDBx:pdbx_nmr_exptl_sample solution_id="2" component="MCP-1">
<PDBx:concentration>1</PDBx:concentration>
<PDBx:concentration_units>mM</PDBx:concentration_units>
<PDBx:isotopic_labeling>U-50% 15N</PDBx:isotopic_labeling>
</PDBx:pdbx_nmr_exptl_sample>
<PDBx:pdbx_nmr_exptl_sample solution_id="2" component="H2O">
<PDBx:concentration>90</PDBx:concentration>
<PDBx:concentration_units>%</PDBx:concentration_units>
</PDBx:pdbx_nmr_exptl_sample>
<PDBx:pdbx_nmr_exptl_sample solution_id="2" component="D2O">
<PDBx:concentration>10</PDBx:concentration>
<PDBx:concentration_units>%</PDBx:concentration_units>
</PDBx:pdbx_nmr_exptl_sample>
</PDBx:pdbx_nmr_exptl_sampleCategory>
The concentration value of the component.
2.0
2.7
0.01
The concentration units of the component.
mg/mL for mg per milliliter
mM for millimolar
% for percent by volume
The isotopic composition of each component, including
the % labeling level, if known. For example:
1. Uniform (random) labeling with 15N: U-15N
2. Uniform (random) labeling with 13C, 15N at known labeling
levels: U-95% 13C;U-98% 15N
3. Residue selective labeling: U-95% 15N-Thymine
4. Site specific labeling: 95% 13C-Ala18,
5. Natural abundance labeling in an otherwise uniformly labled
biomolecule is designated by NA: U-13C; NA-K,H
U-13C,15N
U-2H
The name (number) of the sample.
1
2
3
The name of each component in the sample
ribonuclease
DNA strand 1
TRIS buffer
sodium chloride
H2O
D2O
The experimental conditions used to for each sample. Each set of conditions
is identified by a numerical code.
This example was taken from a pH stability study.
<PDBx:pdbx_nmr_exptl_sample_conditionsCategory>
<PDBx:pdbx_nmr_exptl_sample_conditions conditions_id="1">
<PDBx:temperature>298</PDBx:temperature>
<PDBx:pressure>ambient</PDBx:pressure>
<PDBx:pH>7</PDBx:pH>
<PDBx:ionic_strength>25mM NaCl</PDBx:ionic_strength>
</PDBx:pdbx_nmr_exptl_sample_conditions>
<PDBx:pdbx_nmr_exptl_sample_conditions conditions_id="2">
<PDBx:temperature>298</PDBx:temperature>
<PDBx:pressure>ambient</PDBx:pressure>
<PDBx:pH>3</PDBx:pH>
<PDBx:ionic_strength>25mM NaCl</PDBx:ionic_strength>
</PDBx:pdbx_nmr_exptl_sample_conditions>
</PDBx:pdbx_nmr_exptl_sample_conditionsCategory>
The ionic strength at which the NMR data were collected -in lieu of
this enter the concentration and identity of the salt in the sample.
The pH at which the NMR data were collected.
3.1
7.0
The pressure at which NMR data were collected.
ambient
1atm
The units of pressure at which NMR data were collected.
Pa
atm
Torr
The temperature (in Kelvin) at which NMR data were
collected.
298
The condition number as defined above.
1
2
3
The final force constants, including units, employed for the various
experimental constraints, covalent geometry constraints, and the non-bonded
interaction terms in the target function used for simulated annealing.
This example is taken from a study of BAF, a dimeric DNA binding protein.
The final force constants in the target function used for simulated
annealing are: Experimental Constraint terms: Distance (NOE,H-bonds),
Torsion angles, J coupling, 13C shifts, 1H shifts, Dipolar coupling,
D isotope shifts Covalent Geometry Constraint terms: Bond lengths,
Angles, Impropers Non-bonded Interaction terms: van der Waals,
Type of van der Waals term, Conformational database potential,
Radius of gyration.
<PDBx:pdbx_nmr_force_constantsCategory>
<PDBx:pdbx_nmr_force_constants entry_id="1ABC">
<PDBx:exptl_distance_term>30.</PDBx:exptl_distance_term>
<PDBx:exptl_distance_term_units>kcal/mol/A**2</PDBx:exptl_distance_term_units>
<PDBx:exptl_torsion_angles_term>200.</PDBx:exptl_torsion_angles_term>
<PDBx:exptl_torsion_angles_term_units>kcal/mol/rad**2</PDBx:exptl_torsion_angles_term_units>
<PDBx:exptl_J_coupling_term>1.</PDBx:exptl_J_coupling_term>
<PDBx:exptl_J_coupling_term_units>kcal/mol/Hz**2</PDBx:exptl_J_coupling_term_units>
<PDBx:exptl_13C_shift_term>0.5</PDBx:exptl_13C_shift_term>
<PDBx:exptl_13C_shift_term_units>kcal/mol/ppm**2</PDBx:exptl_13C_shift_term_units>
<PDBx:exptl_1H_shift_term>7.5</PDBx:exptl_1H_shift_term>
<PDBx:exptl_1H_shift_term_units>kcal/mol/ppm**2</PDBx:exptl_1H_shift_term_units>
<PDBx:covalent_geom_bond_term>1000.</PDBx:covalent_geom_bond_term>
<PDBx:covalent_geom_bond_term_units>kcal/mol/A**2</PDBx:covalent_geom_bond_term_units>
<PDBx:non-bonded_inter_van_der_Waals_term_type>4.</PDBx:non-bonded_inter_van_der_Waals_term_type>
</PDBx:pdbx_nmr_force_constants>
</PDBx:pdbx_nmr_force_constantsCategory>
The final force constant for covalent geometry angle constraints
term employed in the target function used for simulated annealing.
500
The units for the force constant for the covalent geometry angle
constraints term.
kcal/mol/rad**2
The final force constant for the covalent geometry bond length
constraints term employed in the target function used for simulated
annealing.
1000
The units for the force constant for the covalent geometry bond
length constraints term.
kcal/mol/A**2
The final force constant for covalent geometry impropers
contstraints term employed in the target function used for simulated
annealing.
500
The units for the force constant for the covalent geometry
impropers constraints term.
kcal/mol/rad**2
The final force constant for 13C shift constraints term employed
in the target function used for simulated annealing.
0.5
The units for the force constant for the 13C shift constraints
term.
kcal/mol/ppm**2
The final force constant for 1H shift constraints term employed
in the target function used for simulated annealing.
7.5
The units for the force constant for the 1H shift constraints term.
kcal/mol/ppm**2
The final force constant for Deuterium isotope shift constraints
term employed in the target function used for simulated annealing.
0.5
The units for the force constant for the Deuterium isotope
shift constraints term.
kcal/mol/ppb**2
The final force constant for J coupling term employed in the
target function used for simulated annealing.
1
The units for the force constant for the J coupling term.
kcal/mol/Hz**2
The final force constant for dipolar coupling constraint term
employed in the target function used for simulated annealing.
1
The units for the force constant for the dipolar coupling
constraints term.
kcal/mol/Hz**2
The final force constant for distance (NOEs) constraints
term employed in the target function used for simulated annealing.
30
The units for the force constant for the distance
constraints term.
kcal/mol/ A**2
The final force constant for the torsion angle term employed in
the target function used for simulated annealing.
200
The units for the force constant for the torsion angle
constraints term.
kcal/mol/rad**2
The force constant used for the non-bonded interaction conformational
database potential term employed in the target function used for simulated
annealing.
1.0
The force constant used for the non-bonded interaction radius of
gyration term employed in the target function used for simulated annealing.
100
The units for the force constant for the radius of gyration term.
kcal/mol/ A**2
The force constant used for the non-bonded interaction van der Waals
term employed in the target function used for simulated annealing.
4
The type of van der Waals term employed in the target function
used for simulated annealing.
quartic
The units for the force constant for the van der Waals term.
kcal/mol/ A**4
You can leave this blank as an ID will be assigned by the RCSB.
Describe the method and details of the refinement of the deposited structure.
This example is drawn from the MCP-1 structure.
<PDBx:pdbx_nmr_refineCategory>
<PDBx:pdbx_nmr_refine entry_id="1ABC">
<PDBx:method>torsion angle dynamics</PDBx:method>
</PDBx:pdbx_nmr_refine>
</PDBx:pdbx_nmr_refineCategory>
Additional details about the NMR refinement.
Additional comments about the NMR refinement can be placed here, e.g.
the structures are based on a total of 3344 restraints, 3167 are NOE-derived
distance constraints, 68 dihedral angle restraints,109 distance restraints
from hydrogen bonds.
The method used to determine the structure.
distance geometry
simulated annealing
molecular dynamics
matrix relaxation
torsion angle dynamics
You can leave this blank as an ID will be assigned by the RCSB
to the constraint file.
An average structure is often calculated in addition to the ensemble, or one
of the ensemble is selected as a representative structure. This section
describes selection of the representative structure.
This example is drawn from the MCP-1 structure.
<PDBx:pdbx_nmr_representativeCategory>
<PDBx:pdbx_nmr_representative entry_id="1ABC">
<PDBx:conformer_id>15</PDBx:conformer_id>
<PDBx:selection_criteria>lowest energy</PDBx:selection_criteria>
</PDBx:pdbx_nmr_representative>
</PDBx:pdbx_nmr_representativeCategory>
If a member of the ensemble has been selected as a representative
structure, identify it by its model number.
15
By highlighting the appropriate choice(s), describe the criteria used to
select this structure as a representative structure, or if an average
structure has been calculated describe how this was done.
The structure closest to the average.
The structure with the lowest energy was selected.
The structure with the fewest number of violations was selected.
A minimized average structure was calculated.
msd will assign the ID.
Complete description of each NMR sample, including the solvent
system used.
This example was taken from the study of MCP-1 which is a dimer under the
conditions studied. Three solutions with different isotope compositions were
studied.
<PDBx:pdbx_nmr_sample_detailsCategory>
<PDBx:pdbx_nmr_sample_details solution_id="1">
<PDBx:solvent_system>MCP-1</PDBx:solvent_system>
<PDBx:contents>2 mM U-15N,13C, H2O 90 %, D2O 10 %</PDBx:contents>
</PDBx:pdbx_nmr_sample_details>
<PDBx:pdbx_nmr_sample_details solution_id="2">
<PDBx:solvent_system>MCP-1</PDBx:solvent_system>
<PDBx:contents>1 mM U-50% 15N, MCP-1 1 mM U-50% 13C, H2O 90 %, D2O 10 %</PDBx:contents>
</PDBx:pdbx_nmr_sample_details>
<PDBx:pdbx_nmr_sample_details solution_id="3">
<PDBx:solvent_system>MCP-1</PDBx:solvent_system>
<PDBx:contents>2 mM U-15N, H2O 90 %, D2O 10 %</PDBx:contents>
</PDBx:pdbx_nmr_sample_details>
</PDBx:pdbx_nmr_sample_detailsCategory>
A complete description of each NMR sample. Include the concentration
and concentration units for each component (include buffers, etc.). For each
component describe the isotopic composition, including the % labeling level,
if known.
For example:
1. Uniform (random) labeling with 15N: U-15N
2. Uniform (random) labeling with 13C, 15N at known labeling
levels: U-95% 13C;U-98% 15N
3. Residue selective labeling: U-95% 15N-Thymine
4. Site specific labeling: 95% 13C-Ala18,
5. Natural abundance labeling in an otherwise uniformly labeled
biomolecule is designated by NA: U-13C; NA-K,H
2mM Ribonuclease U-15N,13C; 50mM phosphate buffer NA; 90% H2O, 10% D2O
The solvent system used for this sample.
90% H2O, 10% D2O
The name (number) of the sample.
1
2
3
Description of the software that was used for data collection, data processing,
data analysis, structure calculations and refinement. The description should
include the name of the software, the author of the software and the version used.
This example describes the software used in the MCP-1 study.
<PDBx:pdbx_nmr_softwareCategory>
<PDBx:pdbx_nmr_software name="UXNMR" version="940501.3" classification="collection">
<PDBx:authors>Bruker</PDBx:authors>
</PDBx:pdbx_nmr_software>
<PDBx:pdbx_nmr_software name="FELIX" version="1.1" classification="processing">
<PDBx:authors>Hare</PDBx:authors>
</PDBx:pdbx_nmr_software>
<PDBx:pdbx_nmr_software name="ANSIG" version="3.0" classification="data analysis">
<PDBx:authors>Kraulis</PDBx:authors>
</PDBx:pdbx_nmr_software>
<PDBx:pdbx_nmr_software name="X-PLOR" version="3.8" classification="structure calculation">
<PDBx:authors>Brunger</PDBx:authors>
</PDBx:pdbx_nmr_software>
<PDBx:pdbx_nmr_software name="X-PLOR" version="3.8" classification="refinement">
<PDBx:authors>Brunger</PDBx:authors>
</PDBx:pdbx_nmr_software>
</PDBx:pdbx_nmr_softwareCategory>
The name of the authors of the software used in this
procedure.
Brunger
Guentert
The name of the software used for the task.
ANSIG
AURELIA
AZARA
CHARMM
CORMA
DIANA
DYANA
DSPACE
DISGEO
DGII
DISMAN
DINOSAUR
DISCOVER
FELIX
FT_NMR
GROMOS
IRMA
MARDIGRAS
NMRPipe
SA
UXNMR
VNMR
X-PLOR
XWINNMR
The version of the software.
940501.3
2.1
The purpose of the software.
collection
processing
data analysis
structure solution
refinement
iterative matrix relaxation
The details about each spectrometer used to collect data for this
deposition.
The instruments described here are the ones used for the MCP-1 studies.
<PDBx:pdbx_nmr_spectrometerCategory>
<PDBx:pdbx_nmr_spectrometer spectrometer_id="1">
<PDBx:type>Bruker AMX</PDBx:type>
<PDBx:field_strength>600</PDBx:field_strength>
</PDBx:pdbx_nmr_spectrometer>
<PDBx:pdbx_nmr_spectrometer spectrometer_id="2">
<PDBx:type>Bruker AMX</PDBx:type>
<PDBx:field_strength>500</PDBx:field_strength>
</PDBx:pdbx_nmr_spectrometer>
</PDBx:pdbx_nmr_spectrometerCategory>
Select the field strength for protons in MHz.
360
400
500
600
750
800
850
900
950
1000
The name of the manufacturer of the spectrometer.
Varian
Bruker
JEOL
GE
The model of the NMR spectrometer.
AVANCE
WH
WM
AM
AMX
DMX
DRX
MSL
OMEGA
OMEGA PSG
GX
GSX
A
AL
EC
EX
LA
ECP
VXRS
UNITY
UNITYPLUS
INOVA
Select the instrument manufacturer(s) and the model(s) of the NMR(s)
used for this work.
Bruker WH
Bruker WM
Bruker AM
Bruker AMX
Bruker DMX
Bruker DRX
Bruker MSL
Bruker AVANCE
GE Omega
GE Omega PSG
JEOL GX
JEOL GSX
JEOL A
JEOL AL
JEOL EC
JEOL EX
JEOL LA
JEOL ECP
Varian VXRS
Varian UNITY
Varian UNITYplus
Varian INOVA
other
Assign a numerical ID to each instrument.
1
2
3
The PDBX_NONPOLY_SCHEME category provides residue level nomenclature
mapping for non-polymer entities.
Example 1 -
<PDBx:pdbx_nonpoly_schemeCategory>
<PDBx:pdbx_nonpoly_scheme asym_id="C">
<PDBx:entity_id>3</PDBx:entity_id>
<PDBx:mon_id>HOH</PDBx:mon_id>
<PDBx:ndb_seq_num>100</PDBx:ndb_seq_num>
<PDBx:pdb_seq_num>100</PDBx:pdb_seq_num>
<PDBx:auth_seq_num>100</PDBx:auth_seq_num>
<PDBx:pdb_mon_id>HOH</PDBx:pdb_mon_id>
<PDBx:auth_mon_id>HOH</PDBx:auth_mon_id>
<PDBx:pdb_strand_id>C</PDBx:pdb_strand_id>
</PDBx:pdbx_nonpoly_scheme>
</PDBx:pdbx_nonpoly_schemeCategory>
attribute auth_comp_id in category atom_site
attribute auth_seq_id in category atom_site
Pointer to attribute label_entity_id in category atom_site.
Pointer to attribute label_comp_id in category atom_site.
NDB residue number.
PDB insertion code.
PDB residue name.
PDB residue number.
PDB strand/chain id.
Pointer to attribute label_asym_id in category atom_site.
1
A
2B3
Record details about each phasing set: (Note: the phasing
set is different from data set. for example: if there are
three data sets, the inflection point (IP), the peak (PK)
and the high remote (HR), the combination of the phasing
set will be IP_iso, PK_iso (the isomorphous repleacement
with HR as 'native'), IP_ano, PK_ano and HR_ano (the
anomalous difference with itself). Therefore, there are
five set used for phasing.
Example 1 - three wavelengths
<PDBx:pdbx_phasing_MAD_setCategory>
<PDBx:pdbx_phasing_MAD_set id="ISO_1">
<PDBx:d_res_low>22.60</PDBx:d_res_low>
<PDBx:d_res_high>2.00</PDBx:d_res_high>
<PDBx:reflns_acentric>5387</PDBx:reflns_acentric>
<PDBx:reflns_centric>471</PDBx:reflns_centric>
<PDBx:R_cullis_acentric>0.000</PDBx:R_cullis_acentric>
<PDBx:R_cullis_centric>0.000</PDBx:R_cullis_centric>
</PDBx:pdbx_phasing_MAD_set>
<PDBx:pdbx_phasing_MAD_set id="ISO_2">
<PDBx:d_res_low>22.60</PDBx:d_res_low>
<PDBx:d_res_high>2.00</PDBx:d_res_high>
<PDBx:reflns_acentric>5365</PDBx:reflns_acentric>
<PDBx:reflns_centric>469</PDBx:reflns_centric>
<PDBx:R_cullis_acentric>0.803</PDBx:R_cullis_acentric>
<PDBx:R_cullis_centric>0.718</PDBx:R_cullis_centric>
</PDBx:pdbx_phasing_MAD_set>
<PDBx:pdbx_phasing_MAD_set id="ISO_3">
<PDBx:d_res_low>22.60</PDBx:d_res_low>
<PDBx:d_res_high>2.00</PDBx:d_res_high>
<PDBx:reflns_acentric>5317</PDBx:reflns_acentric>
<PDBx:reflns_centric>460</PDBx:reflns_centric>
<PDBx:R_cullis_acentric>0.658</PDBx:R_cullis_acentric>
<PDBx:R_cullis_centric>0.500</PDBx:R_cullis_centric>
</PDBx:pdbx_phasing_MAD_set>
<PDBx:pdbx_phasing_MAD_set id="ANO_1">
<PDBx:d_res_low>22.60</PDBx:d_res_low>
<PDBx:d_res_high>2.00</PDBx:d_res_high>
<PDBx:reflns_acentric>5278</PDBx:reflns_acentric>
<PDBx:reflns_centric>0</PDBx:reflns_centric>
<PDBx:R_cullis_acentric>0.841</PDBx:R_cullis_acentric>
<PDBx:R_cullis_centric>0.000</PDBx:R_cullis_centric>
</PDBx:pdbx_phasing_MAD_set>
<PDBx:pdbx_phasing_MAD_set id="ANO_2">
<PDBx:d_res_low>22.60</PDBx:d_res_low>
<PDBx:d_res_high>2.00</PDBx:d_res_high>
<PDBx:reflns_acentric>5083</PDBx:reflns_acentric>
<PDBx:reflns_centric>0</PDBx:reflns_centric>
<PDBx:R_cullis_acentric>0.649</PDBx:R_cullis_acentric>
<PDBx:R_cullis_centric>0.000</PDBx:R_cullis_centric>
</PDBx:pdbx_phasing_MAD_set>
<PDBx:pdbx_phasing_MAD_set id="ANO_3">
<PDBx:d_res_low>22.60</PDBx:d_res_low>
<PDBx:d_res_high>2.00</PDBx:d_res_high>
<PDBx:reflns_acentric>5329</PDBx:reflns_acentric>
<PDBx:reflns_centric>0</PDBx:reflns_centric>
<PDBx:R_cullis_acentric>0.829</PDBx:R_cullis_acentric>
<PDBx:R_cullis_centric>0.000</PDBx:R_cullis_centric>
</PDBx:pdbx_phasing_MAD_set>
</PDBx:pdbx_phasing_MAD_setCategory>
attribute R_cullis in category pdbx_phasing_MAD_set records R_cullis
for MAD phasing.
attribute R_cullis_acentric in category pdbx_phasing_MAD_set records R_cullis
using acentric data for MAD phasing.
attribute R_cullis_centric in category pdbx_phasing_MAD_set records R_cullis
using centric data for MAD phasing.
attribute R_kraut in category pdbx_phasing_MAD_set records R_kraut
for MAD phasing.
attribute r_kraut_acentric in category pdbx_phasing_MAD_set records r_kraut
using acentric data for MAD phasing.
attribute R_kraut_centric in category pdbx_phasing_MAD_set records r_kraut
using centric data for MAD phasing.
attribute d_res_high in category pdbx_phasing_MAD_set records the highest resolution
for the phasing set.
attribute d_res_low in category pdbx_phasing_MAD_set records the lowerest
resolution for phasing set.
attribute fom in category pdbx_phasing_MAD_set records the figure of merit
for MAD phasing.
attribute fom_acentric in category pdbx_phasing_MAD_set records the figure of merit
using acentric data for MAD phasing.
attribute fom_centric in category pdbx_phasing_MAD_set records the figure of merit
using centric data for MAD phasing.
attribute loc in category pdbx_phasing_MAD_set records lack of closure
for MAD phasing.
attribute loc_acentric in category pdbx_phasing_MAD_set records lack of closure
using acentric data for MAD phasing.
attribute loc_centric in category pdbx_phasing_MAD_set records lack of closure
using centric data for MAD phasing.
attribute number_of_sites in category pdbx_phasing_MAD_set records the number of site
refined for the phasing set.
attribute power in category pdbx_phasing_MAD_set records phasing power
for MAD phasing.
attribute power_acentric in category pdbx_phasing_MAD_set records phasing powe
using acentric data for MAD phasing.
attribute power_centric in category pdbx_phasing_MAD_set records phasing powe
using centric data for MAD phasing.
attribute reflns in category pdbx_phasing_MAD_set records the number of
reflections used for MAD phasing.
attribute reflns_acentric in category pdbx_phasing_MAD_set records the number of
acentric reflections for MAD phasing.
attribute reflns_centric in category pdbx_phasing_MAD_set records the number of
centric reflections for MAD phasing.
attribute id in category pdbx_phasing_MAD_set records phase set name
for MAD phasing.
The same as category pdbx_phasing_MAD_set, but
broken into shells.
Example 1 - three wavelengths (SHARP example)
<PDBx:pdbx_phasing_MAD_set_shellCategory>
<PDBx:pdbx_phasing_MAD_set_shell id="ISO_1" d_res_low="22.60" d_res_high="7.77">
<PDBx:reflns_acentric>64</PDBx:reflns_acentric>
<PDBx:reflns_centric>23</PDBx:reflns_centric>
<PDBx:R_cullis_acentric>0.000</PDBx:R_cullis_acentric>
<PDBx:R_cullis_centric>0.000</PDBx:R_cullis_centric>
<PDBx:power_acentric>0.000</PDBx:power_acentric>
<PDBx:power_centric>0.000</PDBx:power_centric>
</PDBx:pdbx_phasing_MAD_set_shell>
<PDBx:pdbx_phasing_MAD_set_shell id="ISO_1" d_res_low="7.77" d_res_high="5.67">
<PDBx:reflns_acentric>130</PDBx:reflns_acentric>
<PDBx:reflns_centric>32</PDBx:reflns_centric>
<PDBx:R_cullis_acentric>0.000</PDBx:R_cullis_acentric>
<PDBx:R_cullis_centric>0.000</PDBx:R_cullis_centric>
<PDBx:power_acentric>0.000</PDBx:power_acentric>
<PDBx:power_centric>0.000</PDBx:power_centric>
</PDBx:pdbx_phasing_MAD_set_shell>
<PDBx:pdbx_phasing_MAD_set_shell id="ISO_1" d_res_low="5.67" d_res_high="4.68">
<PDBx:reflns_acentric>182</PDBx:reflns_acentric>
<PDBx:reflns_centric>27</PDBx:reflns_centric>
<PDBx:R_cullis_acentric>0.000</PDBx:R_cullis_acentric>
<PDBx:R_cullis_centric>0.000</PDBx:R_cullis_centric>
<PDBx:power_acentric>0.000</PDBx:power_acentric>
<PDBx:power_centric>0.000</PDBx:power_centric>
</PDBx:pdbx_phasing_MAD_set_shell>
<PDBx:pdbx_phasing_MAD_set_shell id="ISO_1" d_res_low="4.68" d_res_high="4.07">
<PDBx:reflns_acentric>207</PDBx:reflns_acentric>
<PDBx:reflns_centric>24</PDBx:reflns_centric>
<PDBx:R_cullis_acentric>0.000</PDBx:R_cullis_acentric>
<PDBx:R_cullis_centric>0.000</PDBx:R_cullis_centric>
<PDBx:power_acentric>0.000</PDBx:power_acentric>
<PDBx:power_centric>0.000</PDBx:power_centric>
</PDBx:pdbx_phasing_MAD_set_shell>
<PDBx:pdbx_phasing_MAD_set_shell id="ANO_1" d_res_low="22.60" d_res_high="7.77">
<PDBx:reflns_acentric>62</PDBx:reflns_acentric>
<PDBx:reflns_centric>0</PDBx:reflns_centric>
<PDBx:R_cullis_acentric>0.610</PDBx:R_cullis_acentric>
<PDBx:R_cullis_centric>0.000</PDBx:R_cullis_centric>
<PDBx:power_acentric>1.804</PDBx:power_acentric>
<PDBx:power_centric>0.000</PDBx:power_centric>
</PDBx:pdbx_phasing_MAD_set_shell>
<PDBx:pdbx_phasing_MAD_set_shell id="ANO_1" d_res_low="7.77" d_res_high="5.67">
<PDBx:reflns_acentric>129</PDBx:reflns_acentric>
<PDBx:reflns_centric>0</PDBx:reflns_centric>
<PDBx:R_cullis_acentric>0.532</PDBx:R_cullis_acentric>
<PDBx:R_cullis_centric>0.000</PDBx:R_cullis_centric>
<PDBx:power_acentric>2.382</PDBx:power_acentric>
<PDBx:power_centric>0.000</PDBx:power_centric>
</PDBx:pdbx_phasing_MAD_set_shell>
<PDBx:pdbx_phasing_MAD_set_shell id="ANO_1" d_res_low="5.67" d_res_high="4.68">
<PDBx:reflns_acentric>178</PDBx:reflns_acentric>
<PDBx:reflns_centric>0</PDBx:reflns_centric>
<PDBx:R_cullis_acentric>0.673</PDBx:R_cullis_acentric>
<PDBx:R_cullis_centric>0.000</PDBx:R_cullis_centric>
<PDBx:power_acentric>1.858</PDBx:power_acentric>
<PDBx:power_centric>0.000</PDBx:power_centric>
</PDBx:pdbx_phasing_MAD_set_shell>
<PDBx:pdbx_phasing_MAD_set_shell id="ANO_1" d_res_low="4.68" d_res_high="4.07">
<PDBx:reflns_acentric>204</PDBx:reflns_acentric>
<PDBx:reflns_centric>0</PDBx:reflns_centric>
<PDBx:R_cullis_acentric>0.755</PDBx:R_cullis_acentric>
<PDBx:R_cullis_centric>0.000</PDBx:R_cullis_centric>
<PDBx:power_acentric>1.605</PDBx:power_acentric>
<PDBx:power_centric>0.000</PDBx:power_centric>
</PDBx:pdbx_phasing_MAD_set_shell>
</PDBx:pdbx_phasing_MAD_set_shellCategory>
attribute R_cullis in category pdbx_phasing_MAD_set_shell records R_cullis
for MAD phasing.
attribute R_cullis_acentric in category pdbx_phasing_MAD_set_shell records R_cullis
using acentric data for MAD phasing.
attribute R_cullis_centric in category pdbx_phasing_MAD_set_shell records R_cullis
using centric data for MAD phasing.
attribute R_kraut in category pdbx_phasing_MAD_set_shell records R_kraut
for MAD phasing.
attribute R_kraut_acentric in category pdbx_phasing_MAD_set_shell records R_kraut
using acentric data for MAD phasing.
attribute R_kraut_centric in category pdbx_phasing_MAD_set_shell records R_kraut
using centric data for MAD phasing.
attribute fom in category pdbx_phasing_MAD_set_shell records the figure of merit
for MAD phasing.
attribute fom_acentric in category pdbx_phasing_MAD_set_shell records the figure of merit
using acentric data for MAD phasing.
attribute fom_centric in category pdbx_phasing_MAD_set_shell records the figure of merit
using centric data for MAD phasing.
attribute loc in category pdbx_phasing_MAD_set_shell records lack of closure
for MAD phasing.
attribute loc_acentric in category pdbx_phasing_MAD_set_shell records lack of closure
using acentric data for MAD phasing.
attribute loc_centric in category pdbx_phasing_MAD_set_shell records lack of closure
using centric data for MAD phasing.
attribute power in category pdbx_phasing_MAD_set_shell records phasing power
for MAD phasing.
attribute power_acentric in category pdbx_phasing_MAD_set_shell records phasing powe
using acentric data for MAD phasing.
attribute power_centric in category pdbx_phasing_MAD_set_shell records phasing powe
using centric data for MAD phasing.
attribute reflns in category pdbx_phasing_MAD_set_shell records the number of
reflections used for MAD phasing.
attribute reflns_acentric in category pdbx_phasing_MAD_set_shell records the number of
acentric reflections for MAD phasing.
attribute reflns_centric in category pdbx_phasing_MAD_set_shell records the number of
centric reflections for MAD phasing.
attribute id in category pdbx_phasing_MAD_set_shell records phase set name
for MAD phasing.
attribute d_res_low in category pdbx_phasing_MAD_set_shell records the lowerest
resolution for phasing set.
attribute d_res_high in category pdbx_phasing_MAD_set_shell records the highest resolution
for the phasing set.
record the details (coordinates etc.) of anomalous scatters.
Example 1 - anomalous scatters is Se
<PDBx:pdbx_phasing_MAD_set_siteCategory>
<PDBx:pdbx_phasing_MAD_set_site id="1">
<PDBx:atom_type_symbol>SE</PDBx:atom_type_symbol>
<PDBx:Cartn_x>25.9407</PDBx:Cartn_x>
<PDBx:Cartn_y>-0.103471</PDBx:Cartn_y>
<PDBx:Cartn_z>17.4094</PDBx:Cartn_z>
</PDBx:pdbx_phasing_MAD_set_site>
<PDBx:pdbx_phasing_MAD_set_site id="2">
<PDBx:atom_type_symbol>SE</PDBx:atom_type_symbol>
<PDBx:Cartn_x>30.6534</PDBx:Cartn_x>
<PDBx:Cartn_y>6.62359</PDBx:Cartn_y>
<PDBx:Cartn_z>9.93063</PDBx:Cartn_z>
</PDBx:pdbx_phasing_MAD_set_site>
<PDBx:pdbx_phasing_MAD_set_site id="3">
<PDBx:atom_type_symbol>SE</PDBx:atom_type_symbol>
<PDBx:Cartn_x>-3.26506</PDBx:Cartn_x>
<PDBx:Cartn_y>15.5546</PDBx:Cartn_y>
<PDBx:Cartn_z>53.9529</PDBx:Cartn_z>
</PDBx:pdbx_phasing_MAD_set_site>
</PDBx:pdbx_phasing_MAD_set_siteCategory>
attribute Cartn_x in category pdbx_phasing_MAD_set_site records the X Cartesian
coordinate of site obtained from MAD phasing.
attribute Cartn_x_esd in category pdbx_phasing_MAD_set_site records the estimated
standard deviation X Cartesian
coordinate of site obtained from MAD phasing.
attribute Cartn_y in category pdbx_phasing_MAD_set_site records the Y Cartesian
coordinate of site obtained from MAD phasing.
attribute Cartn_y_esd in category pdbx_phasing_MAD_set_site records the estimated
standard deviation Y Cartesian
coordinate of site obtained from MAD phasing.
attribute Cartn_z in category pdbx_phasing_MAD_set_site records the Z Cartesian
coordinate of site obtained from MAD phasing.
attribute Cartn_z_esd in category pdbx_phasing_MAD_set_site records the estimated
standard deviation Z Cartesian
coordinate of site obtained from MAD phasing.
attribute atom_type_symbol in category pdbx_phasing_MAD_set_site records the name of site
obtained from MAD phasing.
attribute b_iso in category pdbx_phasing_MAD_set_site records isotropic
temperature factor parameterthe for the site
obtained from MAD phasing.
attribute b_iso_esd in category pdbx_phasing_MAD_set_site records estimated
standard deviation of isotropic
temperature factor parameterthe for the site
obtained from MAD phasing.
attribute fract_x in category pdbx_phasing_MAD_set_site records the X fractional
coordinate of site obtained from MAD phasing.
attribute fract_x_esd in category pdbx_phasing_MAD_set_site records the estimated
standard deviation X fractional
coordinate of site obtained from MAD phasing.
attribute fract_y in category pdbx_phasing_MAD_set_site records the Y fractional
coordinate of site obtained from MAD phasing.
attribute fract_y_esd in category pdbx_phasing_MAD_set_site records the estimated
standard deviation Y fractional
coordinate of site obtained from MAD phasing.
attribute fract_z in category pdbx_phasing_MAD_set_site records the Z fractional
coordinate of site obtained from MAD phasing.
attribute fract_z_esd in category pdbx_phasing_MAD_set_site records the estimated
standard deviation Z fractional
coordinate of site obtained from MAD phasing.
attribute occupancy in category pdbx_phasing_MAD_set_site records the fraction
of the atom type presented at this site.
attribute occupancy_esd in category pdbx_phasing_MAD_set_site records estimated
standard deviation of the fraction
of the atom type presented at this site.
The relative real isotropic occupancy of the atom type
present at this heavy-atom site in a given atom site.
record the phasing set.
attribute id in category pdbx_phasing_MAD_set_site records the number of site
obtained from MAD phasing.
Data items in the PDBX_PHASING_MAD_SHELL category record details about
the phasing of the structure, when methods involving multiple
anomalous dispersion techniques are involved (note: the
values are overall, but broken down into shells of resolution)
Example 1 -
<PDBx:pdbx_phasing_MAD_shellCategory>
<PDBx:pdbx_phasing_MAD_shell d_res_low="22.60" d_res_high="7.77">
<PDBx:reflns_acentric>64</PDBx:reflns_acentric>
<PDBx:fom_acentric>0.886</PDBx:fom_acentric>
<PDBx:reflns_centric>23</PDBx:reflns_centric>
<PDBx:fom_centric>0.641</PDBx:fom_centric>
</PDBx:pdbx_phasing_MAD_shell>
<PDBx:pdbx_phasing_MAD_shell d_res_low="7.77" d_res_high="5.67">
<PDBx:reflns_acentric>132</PDBx:reflns_acentric>
<PDBx:fom_acentric>0.863</PDBx:fom_acentric>
<PDBx:reflns_centric>32</PDBx:reflns_centric>
<PDBx:fom_centric>0.642</PDBx:fom_centric>
</PDBx:pdbx_phasing_MAD_shell>
<PDBx:pdbx_phasing_MAD_shell d_res_low="5.67" d_res_high="4.68">
<PDBx:reflns_acentric>182</PDBx:reflns_acentric>
<PDBx:fom_acentric>0.842</PDBx:fom_acentric>
<PDBx:reflns_centric>27</PDBx:reflns_centric>
<PDBx:fom_centric>0.737</PDBx:fom_centric>
</PDBx:pdbx_phasing_MAD_shell>
<PDBx:pdbx_phasing_MAD_shell d_res_low="4.68" d_res_high="4.07">
<PDBx:reflns_acentric>209</PDBx:reflns_acentric>
<PDBx:fom_acentric>0.789</PDBx:fom_acentric>
<PDBx:reflns_centric>24</PDBx:reflns_centric>
<PDBx:fom_centric>0.682</PDBx:fom_centric>
</PDBx:pdbx_phasing_MAD_shell>
<PDBx:pdbx_phasing_MAD_shell d_res_low="4.07" d_res_high="3.65">
<PDBx:reflns_acentric>246</PDBx:reflns_acentric>
<PDBx:fom_acentric>0.772</PDBx:fom_acentric>
<PDBx:reflns_centric>27</PDBx:reflns_centric>
<PDBx:fom_centric>0.633</PDBx:fom_centric>
</PDBx:pdbx_phasing_MAD_shell>
<PDBx:pdbx_phasing_MAD_shell d_res_low="3.65" d_res_high="3.34">
<PDBx:reflns_acentric>260</PDBx:reflns_acentric>
<PDBx:fom_acentric>0.752</PDBx:fom_acentric>
<PDBx:reflns_centric>31</PDBx:reflns_centric>
<PDBx:fom_centric>0.700</PDBx:fom_centric>
</PDBx:pdbx_phasing_MAD_shell>
</PDBx:pdbx_phasing_MAD_shellCategory>
attribute R_cullis in category pdbx_phasing_MAD_shell records R_cullis
for MAD phasing.
attribute R_cullis_acentric in category pdbx_phasing_MAD_shell records R_cullis
using acentric data for MAD phasing.
attribute R_cullis_centric in category pdbx_phasing_MAD_shell records R_cullis
using centric data for MAD phasing.
attribute R_kraut in category pdbx_phasing_MAD_shell records R_kraut
for MAD phasing.
attribute r_kraut_acentric in category pdbx_phasing_MAD_shell records R_kraut
using acentric data for MAD phasing.
attribute R_kraut_centric in category pdbx_phasing_MAD_shell records R_kraut
using centric data for MAD phasing.
attribute fom in category pdbx_phasing_MAD_shell records the figure of merit
for MAD phasing.
attribute fom_acentric in category pdbx_phasing_MAD_shell records the figure of merit
using acentric data for MAD phasing.
attribute fom_centric in category pdbx_phasing_MAD_shell records the figure of merit
using centric data for MAD phasing.
attribute loc in category pdbx_phasing_MAD_shell records lack of closure
for MAD phasing.
attribute loc_acentric in category pdbx_phasing_MAD_shell records lack of closure
using acentric data for MAD phasing.
attribute loc_centric in category pdbx_phasing_MAD_shell records lack of closure
using centric data for MAD phasing.
attribute loc in category pdbx_phasing_MAD_shell records phasing power
for MAD phasing.
attribute power_acentric in category pdbx_phasing_MAD_shell records phasing powe
using acentric data for MAD phasing.
attribute power_centric in category pdbx_phasing_MAD_shell records phasing powe
using centric data for MAD phasing.
attribute reflns in category pdbx_phasing_MAD_shell records the number of
reflections used for MAD phasing.
attribute reflns_acentric in category pdbx_phasing_MAD_shell records the number of
acentric reflections for MAD phasing.
attribute reflns_centric in category pdbx_phasing_MAD_shell records the number of
centric reflections for MAD phasing.
attribute d_res_low in category pdbx_phasing_MAD_shell records the lower resolution
for the shell.
attribute d_res_high in category pdbx_phasing_MAD_shell records the higher resolution
for the shell.
Data items in the PDBX_PHASING_MR category record details about
molecular replacement.
Example 1 - molecular replacement example from program CNS.
<PDBx:pdbx_phasing_MRCategory>
<PDBx:pdbx_phasing_MR entry_id="ABC001">
<PDBx:method_rotation>real-space rotation search</PDBx:method_rotation>
<PDBx:d_res_high_rotation>3.8</PDBx:d_res_high_rotation>
<PDBx:d_res_low_rotation>13.0</PDBx:d_res_low_rotation>
<PDBx:sigma_F_rotation>1.0</PDBx:sigma_F_rotation>
<PDBx:reflns_percent_rotation>97.8</PDBx:reflns_percent_rotation>
<PDBx:method_translation>gerneral using PC-refinement= e2e2</PDBx:method_translation>
<PDBx:d_res_high_translation>4.0</PDBx:d_res_high_translation>
<PDBx:d_res_low_translation>15.0</PDBx:d_res_low_translation>
<PDBx:sigma_F_translation>0</PDBx:sigma_F_translation>
<PDBx:reflns_percent_translation>97.7</PDBx:reflns_percent_translation>
<PDBx:correlation_coeff_Fo_to_Fc>0.586</PDBx:correlation_coeff_Fo_to_Fc>
<PDBx:packing>0.3086</PDBx:packing>
</PDBx:pdbx_phasing_MR>
</PDBx:pdbx_phasing_MRCategory>
The value of attribute R_factor in category pdbx_phasing_MR identifies the R factor
(defined as uasual) after rotation and translation.
The value of attribute R_rigid_body in category pdbx_phasing_MR identifies the R factor
for rigid body refinement after rotation and translation.(In general,
rigid body refinement has to be carried out after molecular
replacement.
The value of attribute correlation_coeff_Fo_to_Fc in category pdbx_phasing_MR identifies
the correlation between the observed and the calculated structure
factor after rotation and translation.
The value of attribute correlation_coeff_Io_to_Ic in category pdbx_phasing_MR identifies
the correlation between the observed and the calculated intensity
(~|F|^2) after rotation and translation.
The value of attribute d_res_high_rotation in category pdbx_phasing_MR identifies
the highest resolution used for rotation search.
The value of attribute d_res_high_translation in category pdbx_phasing_MR identifies
the highest resolution used for translation search.
The value of attribute d_res_low_rotation in category pdbx_phasing_MR identifies
the lowest resolution used for rotation search.
The value of attribute d_res_low_translation in category pdbx_phasing_MR identifies
the lowest resolution used for translation search.
The value of attribute method_rotation in category pdbx_phasing_MR identifies the method
used for rotation search. For example, the rotation method may be
realspace, fastdirect, or direct.
.
The value of attribute method_translation in category pdbx_phasing_MR identifies the method
used for translation search. For example in CNS, the translation method
may be "general" or "phased" with PC refinement target using
"fastf2f2" "e2e2" "e1e1" "f2f2" "f1f1" "residual" "vector".
.
The value of attribute model_details in category pdbx_phasing_MR records the details of
model used. For example, the original model can be truncated by
deleting side chains, doubtful parts, using the monomer if the
original model was an oligomer. The search model may be one
domain of a large molecule. What is the pdb IDs.
The value of attribute packing in category pdbx_phasing_MR identifies the packing of
search model in the unit cell. Too much crystallographic contacts
may indicate a bad search.
The value of attribute reflns_percent_rotation in category pdbx_phasing_MR identifies the
completness of data used for rotation search.
The value of attribute reflns_percent_translation in category pdbx_phasing_MR identifies the
completness of data used for translation search.
The value of attribute sigma_F_rotation in category pdbx_phasing_MR identifies the
sigma cut off of structure factor used for rotation search.
The value of attribute sigma_F_translation in category pdbx_phasing_MR identifies the
sigma cut off of structure factor used for translation search.
The value of attribute sigma_I_rotation in category pdbx_phasing_MR identifies the
sigma cut off of intensity used for rotation search.
The value of attribute sigma_I_translation in category pdbx_phasing_MR identifies the
sigma cut off of intensity used for translation search.
The value of attribute entry_id in category pdbx_phasing_MR identifies the data block.
Data items in the PDBX_PHASING_DM category record details about
density modification
Example 1 - density modification from resolve
<PDBx:pdbx_phasing_dmCategory>
<PDBx:pdbx_phasing_dm entry_id="ABC001">
<PDBx:fom_acentric>0.85</PDBx:fom_acentric>
<PDBx:fom_centric>0.79</PDBx:fom_centric>
<PDBx:fom>0.85</PDBx:fom>
<PDBx:reflns_acentric>11351</PDBx:reflns_acentric>
<PDBx:reflns_centric>1135</PDBx:reflns_centric>
<PDBx:reflns>12486</PDBx:reflns>
</PDBx:pdbx_phasing_dm>
</PDBx:pdbx_phasing_dmCategory>
The value of attribute delta_phi_final in category pdbx_phasing_dm identifies phase difference
after density modification
The value of attribute delta_phi_initial in category pdbx_phasing_dm identifies phase difference
before density modification
The value of attribute fom in category pdbx_phasing_dm identifies the figure of merit
for all the data
The value of attribute fom_acentric in category pdbx_phasing_dm identifies the figure of merit
for acentric data
The value of attribute fom_centric in category pdbx_phasing_dm identifies the figure of merit
for acentric data
The value of attribute mask_type in category pdbx_phasing_dm identifies the type of mask used for
density modification
The value of attribute method in category pdbx_phasing_dm identifies the method used for
density modification
The value of attribute reflns in category pdbx_phasing_dm identifies the number
of centric and acentric reflections.
The value of attribute reflns_acentric in category pdbx_phasing_dm identifies the number
of acentric reflections.
The value of attribute reflns_centric in category pdbx_phasing_dm identifies the number
of centric reflections.
The value of attribute entry_id in category pdbx_phasing_dm identifies the data block.
Data items in the PDBX_PHASING_DM_SHELL category record details about
density modification in resolution shell.
Example 1 - density modification with shells
<PDBx:pdbx_phasing_dm_shellCategory>
<PDBx:pdbx_phasing_dm_shell d_res_low="100.00" d_res_high="7.73">
<PDBx:reflns>502</PDBx:reflns>
<PDBx:fom>0.879</PDBx:fom>
<PDBx:delta_phi_final>24.7</PDBx:delta_phi_final>
</PDBx:pdbx_phasing_dm_shell>
<PDBx:pdbx_phasing_dm_shell d_res_low="7.73" d_res_high="6.24">
<PDBx:reflns>506</PDBx:reflns>
<PDBx:fom>0.857</PDBx:fom>
<PDBx:delta_phi_final>29.2</PDBx:delta_phi_final>
</PDBx:pdbx_phasing_dm_shell>
<PDBx:pdbx_phasing_dm_shell d_res_low="6.24" d_res_high="5.50">
<PDBx:reflns>504</PDBx:reflns>
<PDBx:fom>0.838</PDBx:fom>
<PDBx:delta_phi_final>29.2</PDBx:delta_phi_final>
</PDBx:pdbx_phasing_dm_shell>
<PDBx:pdbx_phasing_dm_shell d_res_low="5.50" d_res_high="5.02">
<PDBx:reflns>502</PDBx:reflns>
<PDBx:fom>0.851</PDBx:fom>
<PDBx:delta_phi_final>25.3</PDBx:delta_phi_final>
</PDBx:pdbx_phasing_dm_shell>
<PDBx:pdbx_phasing_dm_shell d_res_low="5.02" d_res_high="4.67">
<PDBx:reflns>503</PDBx:reflns>
<PDBx:fom>0.831</PDBx:fom>
<PDBx:delta_phi_final>22.7</PDBx:delta_phi_final>
</PDBx:pdbx_phasing_dm_shell>
</PDBx:pdbx_phasing_dm_shellCategory>
The value of attribute delta_phi_final in category pdbx_phasing_dm_shell identifies phase difference
after density modification with resolution shells.
The value of attribute delta_phi_initial in category pdbx_phasing_dm_shell identifies phase difference
before density modification with resolution shells.
The value of attribute fom in category pdbx_phasing_dm_shell identifies the figure of merit
for all the data with resolution shells.
The value of attribute fom_acentric in category pdbx_phasing_dm_shell identifies the figure of merit
for acentric data with resolution shells
The value of attribute fom_centric in category pdbx_phasing_dm_shell identifies the figure of merit
for centric data with resolution shells.
The value of attribute reflns in category pdbx_phasing_dm_shell identifies the number
of centric and acentric reflections with resolution shells.
The value of attribute reflns_acentric in category pdbx_phasing_dm_shell identifies the number
of acentric reflections with resolution shells.
The value of attribute reflns_centric in category pdbx_phasing_dm_shell identifies the number
of centric reflections with resolution shells.
The value of attribute d_res_low in category pdbx_phasing_dm_shell identifies low resolution
The value of attribute d_res_high in category pdbx_phasing_dm_shell identifies high resolution
The PDBX_POLY_SEQ_SCHEME category provides residue level nomenclature
mapping for polymer entities.
Example 1 - based on NDB entry DDFB25
<PDBx:pdbx_poly_seq_schemeCategory>
<PDBx:pdbx_poly_seq_scheme asym_id="A" entity_id="1" seq_id="1" mon_id="C">
<PDBx:pdb_mon_id>C</PDBx:pdb_mon_id>
<PDBx:auth_mon_id>C</PDBx:auth_mon_id>
<PDBx:pdb_strand_id>A</PDBx:pdb_strand_id>
</PDBx:pdbx_poly_seq_scheme>
<PDBx:pdbx_poly_seq_scheme asym_id="A" entity_id="1" seq_id="2" mon_id="G">
<PDBx:pdb_mon_id>G</PDBx:pdb_mon_id>
<PDBx:auth_mon_id>G</PDBx:auth_mon_id>
<PDBx:pdb_strand_id>A</PDBx:pdb_strand_id>
</PDBx:pdbx_poly_seq_scheme>
<PDBx:pdbx_poly_seq_scheme asym_id="A" entity_id="1" seq_id="3" mon_id="T">
<PDBx:pdb_mon_id>T</PDBx:pdb_mon_id>
<PDBx:auth_mon_id>T</PDBx:auth_mon_id>
<PDBx:pdb_strand_id>A</PDBx:pdb_strand_id>
</PDBx:pdbx_poly_seq_scheme>
<PDBx:pdbx_poly_seq_scheme asym_id="A" entity_id="1" seq_id="4" mon_id="+A">
<PDBx:pdb_mon_id>+A</PDBx:pdb_mon_id>
<PDBx:auth_mon_id>+A</PDBx:auth_mon_id>
<PDBx:pdb_strand_id>A</PDBx:pdb_strand_id>
</PDBx:pdbx_poly_seq_scheme>
<PDBx:pdbx_poly_seq_scheme asym_id="A" entity_id="1" seq_id="5" mon_id="C">
<PDBx:pdb_mon_id>C</PDBx:pdb_mon_id>
<PDBx:auth_mon_id>C</PDBx:auth_mon_id>
<PDBx:pdb_strand_id>A</PDBx:pdb_strand_id>
</PDBx:pdbx_poly_seq_scheme>
<PDBx:pdbx_poly_seq_scheme asym_id="A" entity_id="1" seq_id="6" mon_id="G">
<PDBx:pdb_mon_id>G</PDBx:pdb_mon_id>
<PDBx:auth_mon_id>G</PDBx:auth_mon_id>
<PDBx:pdb_strand_id>A</PDBx:pdb_strand_id>
</PDBx:pdbx_poly_seq_scheme>
</PDBx:pdbx_poly_seq_schemeCategory>
attribute auth_comp_id in category atom_site
attribute auth_seq_id in category atom_site
NDB residue number.
PDB insertion code.
PDB residue name.
PDB residue number.
PDB strand/chain id.
Pointer to attribute label_asym_id in category atom_site.
1
A
2B3
Pointer to attribute id in category entity.
Pointer to attribute num in category entity_poly_seq
Pointer to attribute mon_id in category entity_poly_seq.
This category provides a placeholder for pre-release
sequence information. After release this category
should be discarded.
<PDBx:pdbx_prerelease_seqCategory>
<PDBx:pdbx_prerelease_seq entity_id="1">
<PDBx:seq_one_letter_code>GKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGAAFNVEFD</PDBx:seq_one_letter_code>
</PDBx:pdbx_prerelease_seq>
<PDBx:pdbx_prerelease_seq entity_id="2">
<PDBx:seq_one_letter_code>HKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNN</PDBx:seq_one_letter_code>
</PDBx:pdbx_prerelease_seq>
</PDBx:pdbx_prerelease_seqCategory>
Chemical sequence expressed as string of one-letter
amino acid codes.
A for alanine or adenine
B for ambiguous asparagine/aspartic-acid
R for arginine
N for asparagine
D for aspartic-acid
C for cysteine or cystine or cytosine
Q for glutamine
E for glutamic-acid
Z for ambiguous glutamine/glutamic acid
G for glycine or guanine
H for histidine
I for isoleucine
L for leucine
K for lysine
M for methionine
F for phenylalanine
P for proline
S for serine
T for threonine or thymine
W for tryptophan
Y for tyrosine
V for valine
U for uracil
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGAAFNVEFD
This data item is a pointer to attribute id in category entity in the ENTITY category.
Data items in the PDBX_REFINE category record details about
additional structure refinement parameters which are needed
to complete legacy REMARK 3 refinement templates in PDB
format files.
Example 1 - PDB placeholders for refinement program SHELX
<PDBx:pdbx_refineCategory>
<PDBx:pdbx_refine entry_id="ABC001">
<PDBx:R_factor_all_4sig_cutoff>0.174</PDBx:R_factor_all_4sig_cutoff>
<PDBx:R_factor_obs_4sig_cutoff>0.169</PDBx:R_factor_obs_4sig_cutoff>
<PDBx:number_reflns_obs_4sig_cutoff>1263</PDBx:number_reflns_obs_4sig_cutoff>
<PDBx:free_R_factor_4sig_cutoff>0.216</PDBx:free_R_factor_4sig_cutoff>
<PDBx:free_R_val_test_set_ct_4sig_cutoff>164</PDBx:free_R_val_test_set_ct_4sig_cutoff>
<PDBx:free_R_val_test_set_size_perc_4sig_cutoff>1.29</PDBx:free_R_val_test_set_size_perc_4sig_cutoff>
</PDBx:pdbx_refine>
</PDBx:pdbx_refineCategory>
R-value (all reflections, 4 sigma cutoff)
Placeholder for PDB mapping of SHELXL refinement data.
0.174
R-value (all reflections, no cutoff)
Placeholder for PDB mapping of SHELXL refinement data.
R-value (working set, 4 sigma cutoff)
Placeholder for PDB mapping of SHELXL refinement data.
0.169
R-value (working set reflections, no cutoff)
Placeholder for PDB mapping of SHELXL refinement data.
R free value (4 sigma cutoff).
Placeholder for PDB mapping of SHELXL refinement data.
0.216
Free R-value (no cutoff)
Placeholder for PDB mapping of SHELXL refinement data.
Free R-value (4 sigma cutoff)
Placeholder for PDB mapping of SHELXL refinement data.
Free R-value test set count (4 sigma cutoff)
Placeholder for PDB mapping of SHELXL refinement data.
164
Free R-value test set count (no cutoff)
Placeholder for PDB mapping of SHELXL refinement data.
Free R-value test set size (in percent, 4 sigma cutoff)
Placeholder for PDB mapping of SHELXL refinement data.
1.29
Free R-value test set size (in percent, no cutoff)
Placeholder for PDB mapping of SHELXL refinement data.
Total number of reflections (4 sigma cutoff).
Placeholder for PDB mapping of SHELXL refinement data.
1263
Total number of reflections (no cutoff).
Placeholder for PDB mapping of SHELXL refinement data.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Auxilary parameter and topology files used in refinement.
<PDBx:pdbx_refine_aux_fileCategory>
<PDBx:pdbx_refine_aux_file serial_no="1">
<PDBx:file_name>parm_hol.dat</PDBx:file_name>
<PDBx:file_type>PARAMETER</PDBx:file_type>
</PDBx:pdbx_refine_aux_file>
</PDBx:pdbx_refine_aux_fileCategory>
Auxilary file name.
PARAM_NDBX_HIGH.DNA
Auxilary file type.
PARAMETER
Serial number.
Data items in the REFINE_TLS category record details about
TLS parameters used in structure refinement. Note that the
intention is primarily to describe directly refined TLS
parameters, although other methods of obtaining TLS parameters
may be covered, see item attribute method in category pdbx_refine_tls
The [1][1] element of the libration tensor L. This should
be given in the same coordinate frame as the
corresponding anisotropic displacement parameters.
The estimated standard deviation of attribute L[1][1] in category pdbx_refine_tls.
The [1][2] element of the libration tensor L. This should
be given in the same coordinate frame as the
corresponding anisotropic displacement parameters.
The estimated standard deviation of attribute L[1][2] in category pdbx_refine_tls.
The [1][3] element of the libration tensor L. This should
be given in the same coordinate frame as the
corresponding anisotropic displacement parameters.
The estimated standard deviation of attribute L[1][3] in category pdbx_refine_tls.
The [2][2] element of the libration tensor L. This should
be given in the same coordinate frame as the
corresponding anisotropic displacement parameters.
The estimated standard deviation of attribute L[2][2] in category pdbx_refine_tls.
The [2][3] element of the libration tensor L. This should
be given in the same coordinate frame as the
corresponding anisotropic displacement parameters.
The estimated standard deviation of attribute L[2][3] in category pdbx_refine_tls.
The [3][3] element of the libration tensor L. This should
be given in the same coordinate frame as the
corresponding anisotropic displacement parameters.
The estimated standard deviation of attribute L[3][3] in category pdbx_refine_tls.
The [1][1] element of the screw-rotation tensor S. This should
be given in the same coordinate frame as the
corresponding anisotropic displacement parameters.
The trace of S is indeterminate by crystallography, and should
be set to zero.
The estimated standard deviation of attribute S[1][1] in category pdbx_refine_tls.
The [1][2] element of the screw-rotation tensor S. This should
be given in the same coordinate frame as the
corresponding anisotropic displacement parameters.
If the origin is omitted, it is assumed to be the centre of
reaction of the group, in which case S must be symmetric
The estimated standard deviation of attribute S[1][2] in category pdbx_refine_tls.
The [1][3] element of the screw-rotation tensor S. This should
be given in the same coordinate frame as the
corresponding anisotropic displacement parameters.
If the origin is omitted, it is assumed to be the centre of
reaction of the group, in which case S must be symmetric
The estimated standard deviation of attribute S[1][3] in category pdbx_refine_tls.
The [2][1] element of the screw-rotation tensor S. This should
be given in the same coordinate frame as the
corresponding anisotropic displacement parameters.
If the origin is omitted, it is assumed to be the centre of
reaction of the group, in which case S must be symmetric
The estimated standard deviation of attribute S[2][1] in category pdbx_refine_tls.
The [2][2] element of the screw-rotation tensor S. This should
be given in the same coordinate frame as the
corresponding anisotropic displacement parameters.
The trace of S is indeterminate by crystallography, and should
be set to zero.
The estimated standard deviation of attribute S[2][2] in category pdbx_refine_tls.
The [2][3] element of the screw-rotation tensor S. This should
be given in the same coordinate frame as the
corresponding anisotropic displacement parameters.
If the origin is omitted, it is assumed to be the centre of
reaction of the group, in which case S must be symmetric
The estimated standard deviation of attribute S[2][3] in category pdbx_refine_tls.
The [3][1] element of the screw-rotation tensor S. This should
be given in the same coordinate frame as the
corresponding anisotropic displacement parameters.
If the origin is omitted, it is assumed to be the centre of
reaction of the group, in which case S must be symmetric
The estimated standard deviation of attribute S[3][1] in category pdbx_refine_tls.
The [3][2] element of the screw-rotation tensor S. This should
be given in the same coordinate frame as the
corresponding anisotropic displacement parameters.
If the origin is omitted, it is assumed to be the centre of
reaction of the group, in which case S must be symmetric
The estimated standard deviation of attribute S[3][2] in category pdbx_refine_tls.
The [3][3] element of the screw-rotation tensor S. This should
be given in the same coordinate frame as the
corresponding anisotropic displacement parameters.
The trace of S is indeterminate by crystallography, and should
be set to zero.
The estimated standard deviation of attribute S[3][3] in category pdbx_refine_tls.
The [1][1] element of the translation tensor T. This should
be given in the same coordinate frame and units as the
corresponding anisotropic displacement parameters.
The estimated standard deviation of attribute T[1][1] in category pdbx_refine_tls.
The [1][2] element of the translation tensor T. This should
be given in the same coordinate frame and units as the
corresponding anisotropic displacement parameters.
The estimated standard deviation of attribute T[1][2] in category pdbx_refine_tls.
The [1][3] element of the translation tensor T. This should
be given in the same coordinate frame and units as the
corresponding anisotropic displacement parameters.
The estimated standard deviation of attribute T[1][3] in category pdbx_refine_tls.
The [2][2] element of the translation tensor T. This should
be given in the same coordinate frame and units as the
corresponding anisotropic displacement parameters.
The estimated standard deviation of attribute T[2][2] in category pdbx_refine_tls.
The [2][3] element of the translation tensor T. This should
be given in the same coordinate frame and units as the
corresponding anisotropic displacement parameters.
The estimated standard deviation of attribute T[2][3] in category pdbx_refine_tls.
The [3][3] element of the translation tensor T. This should
be given in the same coordinate frame and units as the
corresponding anisotropic displacement parameters.
The estimated standard deviation of attribute T[3][3] in category pdbx_refine_tls.
A description of the TLS group, such as a domain name or a
chemical group name.
Chain A catalytic domain
Chain A Tyr 56 side chain
The method by which the TLS parameters were obtained.
The x coordinate in angstroms of the origin to which the
TLS parameters are referred, specified according to
a set of orthogonal Cartesian axes related to the cell axes as
given in attribute Cartn_transform_axes.
in category atom_sites
If the origin is omitted, it is assumed to be the centre of
reaction of the group, in which case S must be symmetric
The y coordinate in angstroms of the origin to which the
TLS parameters are referred, specified according to
a set of orthogonal Cartesian axes related to the cell axes as
given in attribute Cartn_transform_axes.
in category atom_sites
If the origin is omitted, it is assumed to be the centre of
reaction of the group, in which case S must be symmetric
The z coordinate in angstroms of the origin to which the
TLS parameters are referred, specified according to
a set of orthogonal Cartesian axes related to the cell axes as
given in attribute Cartn_transform_axes.
in category atom_sites
If the origin is omitted, it is assumed to be the centre of
reaction of the group, in which case S must be symmetric
The value of attribute id in category pdbx_refine_tls must uniquely identify a record in
the PDBX_REFINE_TLS list.
Note that this item need not be a number; it can be any unique
identifier.
1
A
Data items in the PDBX_REFINE_TLS_GROUP category record details about
a fragment of a TLS group.
Properties of the TLS group are recorded in PDBX_REFINE_TLS
A component of the identifier for the residue at which the
TLS fragment range begins.
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
1
5A
A component of the identifier for the residue at which the
TLS fragment range begins.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
O
2B3
A component of the identifier for the residue at which the
TLS fragment range begins.
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
1
303
A component of the identifier for the residue at which the
TLS fragment range ends.
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
1
5A
A component of the identifier for the residue at which the
TLS fragment range ends.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
O
2B3
A component of the identifier for the residue at which the
TLS fragment range ends.
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
1
303
This data item is a pointer to attribute id in category pdbx_refine_tls in the
REFINE_TLS category.
A description of the subset of atoms in the specified
range included in the TLS fragment.
The value of attribute id in category pdbx_refine_tls_group must uniquely identify
a record in the REFINE_TLS_GROUP list.
Note that this item need not be a number; it can be any unique
identifier.
1
A
The details about each robotic system used to collect data for this
project.
The name of the manufacturer of the robotic system.
The model of the robotic system.
The type of robotic system used for in the production pathway.
Assign a numerical ID to each instrument.
Data items in the PDBX_STRUCT_SHEET_HBOND category record details
about the hydrogen bonding between residue ranges in a beta sheet.
This category is provided for cases where only a single hydrogen
bond is used to register the two residue ranges. Category
STRUCT_SHEET_HBOND should be used when the initial and terminal
hydrogen bonds for strand pair are known.
A component of the residue identifier for the first partner of the
registration hydrogen bond between two residue ranges in a sheet.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
A component of the residue identifier for the first partner of the
registration hydrogen bond between two residue ranges in a sheet.
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
A component of the residue identifier for the first partner of the
registration hydrogen bond between two residue ranges in a sheet.
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
A component of the residue identifier for the first partner of the
registration hydrogen bond between two residue ranges in a sheet.
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
A component of the residue identifier for the first partner of the
registration hydrogen bond between two residue ranges in a sheet.
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
A component of the residue identifier for the first partner of the
registration hydrogen bond between two residue ranges in a sheet.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
A component of the residue identifier for the first partner of the
registration hydrogen bond between two residue ranges in a sheet.
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
A component of the residue identifier for the first partner of the
registration hydrogen bond between two residue ranges in a sheet.
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
A component of the residue identifier for the first partner of the
registration hydrogen bond between two residue ranges in a sheet.
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
A component of the residue identifier for the second partner of the
registration hydrogen bond between two residue ranges in a sheet.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
A component of the residue identifier for the second partner of the
registration hydrogen bond between two residue ranges in a sheet.
This data item is a pointer to attribute auth_asym_id in category atom_site in the
ATOM_SITE category.
A component of the residue identifier for the second partner of the
registration hydrogen bond between two residue ranges in a sheet.
This data item is a pointer to attribute auth_atom_id in category atom_site in the
ATOM_SITE category.
A component of the residue identifier for the second partner of the
registration hydrogen bond between two residue ranges in a sheet.
This data item is a pointer to attribute auth_comp_id in category atom_site in the
ATOM_SITE category.
A component of the residue identifier for the second partner of the
registration hydrogen bond between two residue ranges in a sheet.
This data item is a pointer to attribute auth_seq_id in category atom_site in the
ATOM_SITE category.
A component of the residue identifier for the second partner of the
registration hydrogen bond between two residue ranges in a sheet.
This data item is a pointer to attribute label_asym_id in category atom_site in the
ATOM_SITE category.
A component of the residue identifier for the second partner of the
registration hydrogen bond between two residue ranges in a sheet.
This data item is a pointer to attribute label_atom_id in category atom_site in the
ATOM_SITE category.
A component of the residue identifier for the second partner of the
registration hydrogen bond between two residue ranges in a sheet.
This data item is a pointer to attribute label_comp_id in category atom_site in the
ATOM_SITE category.
A component of the residue identifier for the second partner of the
registration hydrogen bond between two residue ranges in a sheet.
This data item is a pointer to attribute label_seq_id in category atom_site in the
ATOM_SITE category.
This data item is a pointer to attribute id in category struct_sheet in the
STRUCT_SHEET category.
This data item is a pointer to attribute id in category struct_sheet_range in
the STRUCT_SHEET_RANGE category.
This data item is a pointer to attribute id in category struct_sheet_range in
the STRUCT_SHEET_RANGE category.
Parameter and topology files used in X-PLOR/CNS refinement.
<PDBx:pdbx_xplor_fileCategory>
<PDBx:pdbx_xplor_file serial_no="1">
<PDBx:param_file>parm_hol.dat</PDBx:param_file>
<PDBx:topol_file>topol_hol.dat</PDBx:topol_file>
</PDBx:pdbx_xplor_file>
</PDBx:pdbx_xplor_fileCategory>
Parameter file name in X-PLOR/CNS refinement.
PARAM_NDBX_HIGH.DNA
Topology file name in X-PLOR/CNS refinement.
TOP_NDBX.DNA
Serial number.
Data items in the PHASING category record details about the
phasing of the structure, listing the various methods used in
the phasing process. The details about the application of each
method are listed in the appropriate subcategories.
Example 1 - example is completely hypothetical
<PDBx:phasingCategory>
<PDBx:phasing method="mir"></PDBx:phasing>
<PDBx:phasing method="averaging"></PDBx:phasing>
</PDBx:phasingCategory>
A listing of the method or methods applied to phase this
structure.
phasing by ab initio methods
abinitio
phase improvement by averaging over multiple
images of the structure
averaging
phasing by direct methods
dm
phasing by iterative single wavelength
anomalous scattering
isas
phasing by iterative single wavelength
anomalous scattering
isir
phasing beginning with phases calculated from
an isomorphous structure
isomorphous
phasing by multiple-wavelength anomalous
dispersion
mad
phasing by multiple isomorphous replacement
mir
phasing by multiple isomorphous replacement
with anomalous scattering
miras
phasing by molecular replacement
mr
phasing by single isomorphous replacement
sir
phasing by single isomorphous replacement
with anomalous scattering.
siras
Data items in the PHASING_MAD category record details about
the phasing of the structure, when methods involving multiple
anomalous dispersion techniques are involved.
Example 1 - based on a paper by Shapiro et al. [(1995). Nature (London),
374, 327-337]
<PDBx:phasing_MADCategory>
<PDBx:phasing_MAD entry_id="NCAD"></PDBx:phasing_MAD>
</PDBx:phasing_MADCategory>
A description of special aspects of the MAD phasing.
A description of the MAD phasing method applied to phase
this structure.
Note that this is not the computer program used, which is
described in the SOFTWARE category, but rather the method
itself.
This data item should be used to describe significant
methodological options used within the MAD phasing program.
phasing_MAD.pdbx_R_cullis records R_cullis
for MAD phasing.
attribute pdbx_R_cullis_acentric in category phasing_MAD records R_cullis
using acentric data for MAD phasing.
attribute pdbx_R_cullis_centric in category phasing_MAD records R_cullis
using centric data for MAD phasing.
attribute pdbx_R_kraut in category phasing_MAD records R_kraut
for MAD phasing.
attribute pdbx_R_kraut_acentric in category phasing_MAD records R_kraut
using acentric data for MAD phasing.
attribute pdbx_R_kraut_centric in category phasing_MAD records R_kraut
using centric data for MAD phasing.
attribute pdbx_d_res_high in category phasing_MAD records the highest resolution
for MAD phasing.
attribute pdbx_d_res_low in category phasing_MAD records the lowest resolution
for MAD phasing.
attribute pdbx_fom in category phasing_MAD records the figure of merit
for MAD phasing.
attribute pdbx_fom_acentric in category phasing_MAD records the figure of merit
using acentric data for MAD phasing.
attribute pdbx_fom_centric in category phasing_MAD records the figure of merit
using centric data for MAD phasing.
phasing_MAD.pdbx_loc records lack of closure
for MAD phasing.
phasing_MAD.pdbx_loc_acentric records lack of closure
using acentric data for MAD phasing.
phasing_MAD.pdbx_loc_centric records lack of closure
using centric data for MAD phasing.
phasing_MAD.pdbx_loc records phasing power
for MAD phasing.
phasing_MAD.pdbx_power_acentric records phasing powe
using acentric data for MAD phasing.
phasing_MAD.pdbx_power_centric records phasing powe
using centric data for MAD phasing.
attribute pdbx_reflns in category phasing_MAD records the number of
reflections used for MAD phasing.
attribute pdbx_reflns_acentric in category phasing_MAD records the number of
acentric reflections for MAD phasing.
attribute pdbx_reflns_centric in category phasing_MAD records the number of
centric reflections for MAD phasing.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the PHASING_MAD_CLUST category record details
about a cluster of experiments that contributed to the
generation of a set of phases.
Example 1 - based on a paper by Shapiro et al. [(1995). Nature (London),
374, 327-337]
<PDBx:phasing_MAD_clustCategory>
<PDBx:phasing_MAD_clust id="four wavelength" expt_id="1">
<PDBx:number_set>4</PDBx:number_set>
</PDBx:phasing_MAD_clust>
<PDBx:phasing_MAD_clust id="five wavelength" expt_id="1">
<PDBx:number_set>5</PDBx:number_set>
</PDBx:phasing_MAD_clust>
<PDBx:phasing_MAD_clust id="five wavelength" expt_id="2">
<PDBx:number_set>5</PDBx:number_set>
</PDBx:phasing_MAD_clust>
</PDBx:phasing_MAD_clustCategory>
The number of data sets in this cluster of data sets.
This data item is a pointer to attribute id in category phasing_MAD_expt in the
PHASING_MAD_EXPT category.
The value of attribute id in category phasing_MAD_clust must, together with
attribute expt_id in category phasing_MAD_clust uniquely identify a record in the
PHASING_MAD_CLUST list.
Note that this item need not be a number; it can be any unique
identifier.
Data items in the PHASING_MAD_EXPT category record details about
a MAD phasing experiment, such as the number of experiments that
were clustered together to produce a set of phases, the
statistics for those phases, and so on.
Example 1 - based on a paper by Shapiro et al. [(1995). Nature (London),
374, 327-337]
<PDBx:phasing_MAD_exptCategory>
<PDBx:phasing_MAD_expt id="1">
<PDBx:number_clust>2</PDBx:number_clust>
<PDBx:R_normal_all>0.063</PDBx:R_normal_all>
<PDBx:R_normal_anom_scat>0.451</PDBx:R_normal_anom_scat>
<PDBx:delta_delta_phi>58.5</PDBx:delta_delta_phi>
<PDBx:delta_phi_sigma>20.3</PDBx:delta_phi_sigma>
<PDBx:mean_fom>0.88</PDBx:mean_fom>
</PDBx:phasing_MAD_expt>
<PDBx:phasing_MAD_expt id="2">
<PDBx:number_clust>1</PDBx:number_clust>
<PDBx:R_normal_all>0.051</PDBx:R_normal_all>
<PDBx:R_normal_anom_scat>0.419</PDBx:R_normal_anom_scat>
<PDBx:delta_delta_phi>36.8</PDBx:delta_delta_phi>
<PDBx:delta_phi_sigma>18.2</PDBx:delta_phi_sigma>
<PDBx:mean_fom>0.93</PDBx:mean_fom>
</PDBx:phasing_MAD_expt>
</PDBx:phasing_MAD_exptCategory>
Definition...
Definition...
The difference between two independent determinations of
attribute delta_phi in category phasing_MAD_expt.
The phase difference between F~t~(h), the structure factor due
to normal scattering from all atoms, and F~a~(h), the structure
factor due to normal scattering from only the anomalous
scatterers.
The estimated standard deviation of attribute delta_phi in category phasing_MAD_expt.
The mean figure of merit.
The number of clusters of data sets in this phasing experiment.
The value of attribute id in category phasing_MAD_expt must uniquely identify each
record in the PHASING_MAD_EXPT list.
Data items in the PHASING_MAD_RATIO category record
the ratios of phasing statistics between pairs of data sets
in a MAD phasing experiment, in given shells of resolution.
Example 1 - based on a paper by Shapiro et al. [(1995). Nature (London),
374, 327-337]
<PDBx:phasing_MAD_ratioCategory>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="four wavelength" wavelength_1="1.4013" wavelength_2="1.4013">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.084</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.076</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="four wavelength" wavelength_1="1.4013" wavelength_2="1.3857">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.067</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="four wavelength" wavelength_1="1.4013" wavelength_2="1.3852">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.051</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="four wavelength" wavelength_1="1.4013" wavelength_2="1.3847">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.044</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="four wavelength" wavelength_1="1.3857" wavelength_2="1.3857">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.110</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.049</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="four wavelength" wavelength_1="1.3857" wavelength_2="1.3852">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.049</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="four wavelength" wavelength_1="1.3857" wavelength_2="1.3847">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.067</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="four wavelength" wavelength_1="1.3852" wavelength_2="1.3852">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.149</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.072</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="four wavelength" wavelength_1="1.3852" wavelength_2="1.3847">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.039</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="four wavelength" wavelength_1="1.3847" wavelength_2="1.3847">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.102</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.071</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="four wavelength" wavelength_1="1.4013" wavelength_2="1.4013">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.114</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.111</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="four wavelength" wavelength_1="1.4013" wavelength_2="1.3857">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.089</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="four wavelength" wavelength_1="1.4013" wavelength_2="1.3852">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.086</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="four wavelength" wavelength_1="1.4013" wavelength_2="1.3847">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.077</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="four wavelength" wavelength_1="1.3857" wavelength_2="1.3857">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.140</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.127</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="four wavelength" wavelength_1="1.3857" wavelength_2="1.3852">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.085</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="four wavelength" wavelength_1="1.3857" wavelength_2="1.3847">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.089</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="four wavelength" wavelength_1="1.3852" wavelength_2="1.3852">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.155</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.119</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="four wavelength" wavelength_1="1.3852" wavelength_2="1.3847">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.082</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="four wavelength" wavelength_1="1.3847" wavelength_2="1.3847">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.124</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.120</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3857" wavelength_2="1.3857">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.075</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.027</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3857" wavelength_2="1.3852">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.041</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3857" wavelength_2="1.3847">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.060</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3857" wavelength_2="1.3784">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.057</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3857" wavelength_2="1.2862">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.072</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3852" wavelength_2="1.3852">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.105</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.032</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3852" wavelength_2="1.3847">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.036</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3852" wavelength_2="1.3784">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.044</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3852" wavelength_2="1.2862">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.065</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3847" wavelength_2="1.3847">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.072</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.031</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3847" wavelength_2="1.3784">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.040</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3847" wavelength_2="1.2862">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.059</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3784" wavelength_2="1.3784">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.059</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.032</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3784" wavelength_2="1.2862">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.059</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.2862" wavelength_2="1.3847">
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>4.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.058</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.028</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3857" wavelength_2="1.3857">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.078</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.075</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3857" wavelength_2="1.3852">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.059</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3857" wavelength_2="1.3847">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.067</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3857" wavelength_2="1.3784">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.084</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3857" wavelength_2="1.2862">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.073</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3852" wavelength_2="1.3852">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.101</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.088</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3852" wavelength_2="1.3847">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.066</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3852" wavelength_2="1.3784">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.082</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3852" wavelength_2="1.2862">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.085</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3847" wavelength_2="1.3847">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.097</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.074</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3847" wavelength_2="1.3784">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.081</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3847" wavelength_2="1.2862">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.085</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3784" wavelength_2="1.3784">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.114</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.089</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.3784" wavelength_2="1.2862">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.103</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="1" clust_id="five wavelength" wavelength_1="1.2862" wavelength_2="1.2862">
<PDBx:d_res_low>4.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.062</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.060</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7263" wavelength_2="0.7263">
<PDBx:d_res_low>15.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.035</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.026</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7263" wavelength_2="0.7251">
<PDBx:d_res_low>15.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.028</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7263" wavelength_2="0.7284">
<PDBx:d_res_low>15.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.023</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7263" wavelength_2="0.7246">
<PDBx:d_res_low>15.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.025</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7263" wavelength_2="0.7217">
<PDBx:d_res_low>15.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.026</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7251" wavelength_2="0.7251">
<PDBx:d_res_low>15.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.060</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.026</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7251" wavelength_2="0.7284">
<PDBx:d_res_low>15.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.029</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7251" wavelength_2="0.7246">
<PDBx:d_res_low>15.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.031</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7251" wavelength_2="0.7217">
<PDBx:d_res_low>15.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.035</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7284" wavelength_2="0.7284">
<PDBx:d_res_low>15.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.075</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.030</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7284" wavelength_2="0.7246">
<PDBx:d_res_low>15.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.023</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7284" wavelength_2="0.7217">
<PDBx:d_res_low>15.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.027</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7246" wavelength_2="0.7246">
<PDBx:d_res_low>15.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.069</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.026</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7246" wavelength_2="0.7217">
<PDBx:d_res_low>15.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.024</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7217" wavelength_2="0.7284">
<PDBx:d_res_low>15.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.060</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.028</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7263" wavelength_2="0.7263">
<PDBx:d_res_low>3.00</PDBx:d_res_low>
<PDBx:d_res_high>1.90</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.060</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.050</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7263" wavelength_2="0.7251">
<PDBx:d_res_low>3.00</PDBx:d_res_low>
<PDBx:d_res_high>1.90</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.056</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7263" wavelength_2="0.7284">
<PDBx:d_res_low>3.00</PDBx:d_res_low>
<PDBx:d_res_high>1.90</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.055</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7263" wavelength_2="0.7246">
<PDBx:d_res_low>3.00</PDBx:d_res_low>
<PDBx:d_res_high>1.90</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.053</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7263" wavelength_2="0.7217">
<PDBx:d_res_low>3.00</PDBx:d_res_low>
<PDBx:d_res_high>1.90</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.056</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7251" wavelength_2="0.7251">
<PDBx:d_res_low>3.00</PDBx:d_res_low>
<PDBx:d_res_high>1.90</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.089</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.050</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7251" wavelength_2="0.7284">
<PDBx:d_res_low>3.00</PDBx:d_res_low>
<PDBx:d_res_high>1.90</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.054</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7251" wavelength_2="0.7246">
<PDBx:d_res_low>3.00</PDBx:d_res_low>
<PDBx:d_res_high>1.90</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.058</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7251" wavelength_2="0.7217">
<PDBx:d_res_low>3.00</PDBx:d_res_low>
<PDBx:d_res_high>1.90</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.063</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7284" wavelength_2="0.7284">
<PDBx:d_res_low>3.00</PDBx:d_res_low>
<PDBx:d_res_high>1.90</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.104</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.057</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7284" wavelength_2="0.7246">
<PDBx:d_res_low>3.00</PDBx:d_res_low>
<PDBx:d_res_high>1.90</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.052</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7284" wavelength_2="0.7217">
<PDBx:d_res_low>3.00</PDBx:d_res_low>
<PDBx:d_res_high>1.90</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.057</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7246" wavelength_2="0.7246">
<PDBx:d_res_low>3.00</PDBx:d_res_low>
<PDBx:d_res_high>1.90</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.098</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.052</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7246" wavelength_2="0.7217">
<PDBx:d_res_low>3.00</PDBx:d_res_low>
<PDBx:d_res_high>1.90</PDBx:d_res_high>
<PDBx:ratio_two_wl>0.054</PDBx:ratio_two_wl>
</PDBx:phasing_MAD_ratio>
<PDBx:phasing_MAD_ratio expt_id="2" clust_id="five wavelength" wavelength_1="0.7217" wavelength_2="0.7284">
<PDBx:d_res_low>3.00</PDBx:d_res_low>
<PDBx:d_res_high>1.90</PDBx:d_res_high>
<PDBx:ratio_one_wl>0.089</PDBx:ratio_one_wl>
<PDBx:ratio_one_wl_centric>0.060</PDBx:ratio_one_wl_centric>
</PDBx:phasing_MAD_ratio>
</PDBx:phasing_MAD_ratioCategory>
The highest resolution for the interplanar spacing in the
reflection data used for this comparison of Bijvoet differences.
This is the smallest d value.
The lowest resolution for the interplanar spacing in the
reflection data used for this comparison of Bijvoet differences.
This is the largest d value.
The root mean square Bijvoet difference at one wavelength for
all reflections.
The root mean square Bijvoet difference at one wavelength for
centric reflections. This would be equal to zero for perfect
data, and thus serves as an estimate of the noise in the
anomalous signals.
The root mean square dispersive Bijvoet difference between
two wavelengths for all reflections.
This data item is a pointer to attribute id in category phasing_MAD_clust in
the PHASING_MAD_CLUST category.
This data item is a pointer to attribute id in category phasing_MAD_expt in the
PHASING_MAD_EXPT category.
This data item is a pointer to attribute wavelength in category phasing_MAD_set in
the PHASING_MAD_SET category.
This data item is a pointer to attribute wavelength in category phasing_MAD_set in
the PHASING_MAD_SET category.
Data items in the PHASING_MAD_SET category record
details about the individual data sets used in a MAD phasing
experiment.
Example 1 - based on a paper by Shapiro et al. [(1995). Nature (London),
374, 327-337]
<PDBx:phasing_MAD_setCategory>
<PDBx:phasing_MAD_set expt_id="1" clust_id="four wavelength" set_id="aa" wavelength="1.4013">
<PDBx:wavelength_details>pre-edge</PDBx:wavelength_details>
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:f_prime>-12.48</PDBx:f_prime>
<PDBx:f_double_prime>3.80</PDBx:f_double_prime>
</PDBx:phasing_MAD_set>
<PDBx:phasing_MAD_set expt_id="1" clust_id="four wavelength" set_id="bb" wavelength="1.3857">
<PDBx:wavelength_details>peak</PDBx:wavelength_details>
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:f_prime>-31.22</PDBx:f_prime>
<PDBx:f_double_prime>17.20</PDBx:f_double_prime>
</PDBx:phasing_MAD_set>
<PDBx:phasing_MAD_set expt_id="1" clust_id="four wavelength" set_id="cc" wavelength="1.3852">
<PDBx:wavelength_details>edge</PDBx:wavelength_details>
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:f_prime>-13.97</PDBx:f_prime>
<PDBx:f_double_prime>29.17</PDBx:f_double_prime>
</PDBx:phasing_MAD_set>
<PDBx:phasing_MAD_set expt_id="1" clust_id="four wavelength" set_id="dd" wavelength="1.3847">
<PDBx:wavelength_details>remote</PDBx:wavelength_details>
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:f_prime>-6.67</PDBx:f_prime>
<PDBx:f_double_prime>17.34</PDBx:f_double_prime>
</PDBx:phasing_MAD_set>
<PDBx:phasing_MAD_set expt_id="1" clust_id="five wavelength" set_id="ee" wavelength="1.3857">
<PDBx:wavelength_details>ascending edge</PDBx:wavelength_details>
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:f_prime>-28.33</PDBx:f_prime>
<PDBx:f_double_prime>14.84</PDBx:f_double_prime>
</PDBx:phasing_MAD_set>
<PDBx:phasing_MAD_set expt_id="1" clust_id="five wavelength" set_id="ff" wavelength="1.3852">
<PDBx:wavelength_details>peak</PDBx:wavelength_details>
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:f_prime>-21.50</PDBx:f_prime>
<PDBx:f_double_prime>30.23</PDBx:f_double_prime>
</PDBx:phasing_MAD_set>
<PDBx:phasing_MAD_set expt_id="1" clust_id="five wavelength" set_id="gg" wavelength="1.3847">
<PDBx:wavelength_details>descending edge</PDBx:wavelength_details>
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:f_prime>-10.71</PDBx:f_prime>
<PDBx:f_double_prime>20.35</PDBx:f_double_prime>
</PDBx:phasing_MAD_set>
<PDBx:phasing_MAD_set expt_id="1" clust_id="five wavelength" set_id="hh" wavelength="1.3784">
<PDBx:wavelength_details>remote 1</PDBx:wavelength_details>
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:f_prime>-14.45</PDBx:f_prime>
<PDBx:f_double_prime>11.84</PDBx:f_double_prime>
</PDBx:phasing_MAD_set>
<PDBx:phasing_MAD_set expt_id="1" clust_id="five wavelength" set_id="ii" wavelength="1.2862">
<PDBx:wavelength_details>remote 2</PDBx:wavelength_details>
<PDBx:d_res_low>20.00</PDBx:d_res_low>
<PDBx:d_res_high>3.00</PDBx:d_res_high>
<PDBx:f_prime>-9.03</PDBx:f_prime>
<PDBx:f_double_prime>9.01</PDBx:f_double_prime>
</PDBx:phasing_MAD_set>
<PDBx:phasing_MAD_set expt_id="2" clust_id="five wavelength" set_id="jj" wavelength="0.7263">
<PDBx:wavelength_details>pre-edge</PDBx:wavelength_details>
<PDBx:d_res_low>15.00</PDBx:d_res_low>
<PDBx:d_res_high>1.90</PDBx:d_res_high>
<PDBx:f_prime>-21.10</PDBx:f_prime>
<PDBx:f_double_prime>4.08</PDBx:f_double_prime>
</PDBx:phasing_MAD_set>
<PDBx:phasing_MAD_set expt_id="2" clust_id="five wavelength" set_id="kk" wavelength="0.7251">
<PDBx:wavelength_details>edge</PDBx:wavelength_details>
<PDBx:d_res_low>15.00</PDBx:d_res_low>
<PDBx:d_res_high>1.90</PDBx:d_res_high>
<PDBx:f_prime>-34.72</PDBx:f_prime>
<PDBx:f_double_prime>7.92</PDBx:f_double_prime>
</PDBx:phasing_MAD_set>
<PDBx:phasing_MAD_set expt_id="2" clust_id="five wavelength" set_id="ll" wavelength="0.7248">
<PDBx:wavelength_details>peak</PDBx:wavelength_details>
<PDBx:d_res_low>15.00</PDBx:d_res_low>
<PDBx:d_res_high>1.90</PDBx:d_res_high>
<PDBx:f_prime>-24.87</PDBx:f_prime>
<PDBx:f_double_prime>10.30</PDBx:f_double_prime>
</PDBx:phasing_MAD_set>
<PDBx:phasing_MAD_set expt_id="2" clust_id="five wavelength" set_id="mm" wavelength="0.7246">
<PDBx:wavelength_details>descending edge</PDBx:wavelength_details>
<PDBx:d_res_low>15.00</PDBx:d_res_low>
<PDBx:d_res_high>1.90</PDBx:d_res_high>
<PDBx:f_prime>-17.43</PDBx:f_prime>
<PDBx:f_double_prime>9.62</PDBx:f_double_prime>
</PDBx:phasing_MAD_set>
<PDBx:phasing_MAD_set expt_id="2" clust_id="five wavelength" set_id="nn" wavelength="0.7217">
<PDBx:wavelength_details>remote</PDBx:wavelength_details>
<PDBx:d_res_low>15.00</PDBx:d_res_low>
<PDBx:d_res_high>1.90</PDBx:d_res_high>
<PDBx:f_prime>-13.26</PDBx:f_prime>
<PDBx:f_double_prime>8.40</PDBx:f_double_prime>
</PDBx:phasing_MAD_set>
</PDBx:phasing_MAD_setCategory>
The highest resolution for the interplanar spacing in the
reflection data used for this set of data. This is the smallest
d value.
The lowest resolution for the interplanar spacing in the
reflection data used for this set of data. This is the largest
d value.
The f'' component of the anomalous scattering factor for this
wavelength.
The f' component of the anomalous scattering factor for this
wavelength.
record the type of heavy atoms which produce anomolous singal.
record the refined f_double_prime (not from experiment).
record the refined f_prime (not from experiment).
A descriptor for this wavelength in this cluster of data sets.
peak
remote
ascending edge
This data item is a pointer to attribute id in category phasing_MAD_expt in the
PHASING_MAD_EXPT category.
This data item is a pointer to attribute id in category phasing_MAD_clust in
the PHASING_MAD_CLUST category.
This data item is a pointer to attribute id in category phasing_set in the
PHASING_SET category.
The wavelength at which this data set was measured.
Data items in the PHASING_MIR category record details about
the phasing of the structure, when methods involving isomorphous
replacement are involved.
All isomorphous based techniques are subsumed in this category,
including single isomorphous replacement (SIR), multiple
isomorphous replacement (MIR), single or multiple isomorphous
replacement plus anomalous scattering (SIRAS, MIRAS).
Example 1 - based on a paper by Zanotti et al. [(1993). J. Biol. Chem.
268, 10728-10738].
<PDBx:phasing_MIRCategory>
<PDBx:phasing_MIR>
<PDBx:method> Standard phase refinement (Blow & Crick, 1959)</PDBx:method>
</PDBx:phasing_MIR>
</PDBx:phasing_MIRCategory>
The mean value of the figure of merit m for all reflections
phased in the native data set.
int P~alpha~ exp(i*alpha) dalpha
m = --------------------------------
int P~alpha~ dalpha
P~a~ = the probability that phase angle a is correct
the integral is taken over the range alpha = 0 to 2 pi.
The mean value of the figure of merit m for the acentric
reflections phased in the native data set.
int P~alpha~ exp(i*alpha) dalpha
m = --------------------------------
int P~alpha~ dalpha
P~a~ = the probability that phase angle a is correct
the integral is taken over the range alpha = 0 to 2 pi.
The mean value of the figure of merit m for the centric
reflections phased in the native data set.
int P~alpha~ exp(i*alpha) dalpha
m = --------------------------------
int P~alpha~ dalpha
P~a~ = the probability that phase angle a is correct
the integral is taken over the range alpha = 0 to 2 pi.
The highest resolution in angstroms for the interplanar spacing
in the reflection data used for the native data set. This is
the smallest d value.
The lowest resolution in angstroms for the interplanar spacing
in the reflection data used for the native data set. This is
the largest d value.
A description of special aspects of the isomorphous phasing.
A description of the MIR phasing method applied to phase this
structure.
Note that this is not the computer program used, which is
described in the SOFTWARE category, but rather the method
itself.
This data item should be used to describe significant
methodological options used within the MIR phasing program.
The total number of reflections phased in the native data set.
The number of acentric reflections phased in the native data
set.
The number of centric reflections phased in the native data
set.
Criterion used to limit the reflections used in the phasing
calculations.
> 4 \s(I)
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the PHASING_MIR_DER category record details
about individual derivatives used in the phasing of the
structure when methods involving isomorphous replacement are
involved.
A derivative in this context does not necessarily equate with
a data set; for instance, the same data set could be used to
one resolution limit as an isomorphous scatterer and to a
different resolution (and with a different sigma cutoff) as an
anomalous scatterer. These would be treated as two distinct
derivatives, although both derivatives would point to the same
data sets via attribute der_set_id in category phasing_MIR_der and
attribute native_set_id in category phasing_MIR_der.
Example 1 - based on a paper by Zanotti et al. [(1993). J. Biol. Chem.
268, 10728-10738].
<PDBx:phasing_MIR_derCategory>
<PDBx:phasing_MIR_der id="KAu(CN)2">
<PDBx:number_of_sites>3</PDBx:number_of_sites>
<PDBx:details>major site interpreted in difference Patterson</PDBx:details>
</PDBx:phasing_MIR_der>
<PDBx:phasing_MIR_der id="K2HgI4">
<PDBx:number_of_sites>6</PDBx:number_of_sites>
<PDBx:details>sites found in cross-difference Fourier</PDBx:details>
</PDBx:phasing_MIR_der>
<PDBx:phasing_MIR_der id="K3IrCl6">
<PDBx:number_of_sites>2</PDBx:number_of_sites>
<PDBx:details>sites found in cross-difference Fourier</PDBx:details>
</PDBx:phasing_MIR_der>
<PDBx:phasing_MIR_der id="All">
<PDBx:number_of_sites>11</PDBx:number_of_sites>
<PDBx:details>data for all three derivatives combined</PDBx:details>
</PDBx:phasing_MIR_der>
</PDBx:phasing_MIR_derCategory>
Residual factor R~cullis,acen~ for acentric reflections in this
derivative.
The Cullis R factor was originally defined only for centric
reflections. It is, however, also a useful statistical
measure for acentric reflections, which is how it is used in
this data item.
sum| |Fph~obs~ +/- Fp~obs~| - Fh~calc~ |
R~cullis,acen~ = ----------------------------------------
sum|Fph~obs~ - Fp~obs~|
Fp~obs~ = the observed structure factor amplitude of the native
Fph~obs~ = the observed structure factor amplitude of the
derivative
Fh~calc~ = the calculated structure factor amplitude from the
heavy atom model
sum is taken over the specified reflections
Ref: Cullis, A. F., Muirhead, H., Perutz, M. F., Rossmann, M. G.
& North, A. C. T. (1961). Proc. Roy. Soc. A265, 15-38.
Residual factor R~cullis,ano~ for anomalous reflections in this
derivative.
The Cullis R factor was originally defined only for centric
reflections. It is, however, also a useful statistical
measure for anomalous reflections, which is how it is used in
this data item.
This is tabulated for acentric terms. Any value <1.0 means
there is some contribution to the phasing from the anomalous
data.
sum| |Fph+~obs~Fph-~obs~ - Fh+~calc~ - Fh-~calc~| |
R~cullis,ano~ = ---------------------------------------------------
sum|Fph+~obs~ - Fph-~obs~|
Fph+~obs~ = the observed positive Friedel structure factor
amplitude for the derivative
Fph-~obs~ = the observed negative Friedel structure factor
amplitude for the derivative
Fh+~calc~ = the calculated positive Friedel structure factor
amplitude from the heavy atom model
Fh-~calc~ = the calculated negative Friedel structure factor
amplitude from the heavy atom model
sum is taken over the specified reflections
Ref: Cullis, A. F., Muirhead, H., Perutz, M. F., Rossmann, M. G.
& North, A. C. T. (1961). Proc. Roy. Soc. A265, 15-38.
Residual factor R~cullis~ for centric reflections in this
derivative.
sum| |Fph~obs~ +/- Fp~obs~| - Fh~calc~ |
R~cullis~ = ----------------------------------------
sum|Fph~obs~ - Fp~obs~|
Fp~obs~ = the observed structure factor amplitude of the native
Fph~obs~ = the observed structure factor amplitude of the
derivative
Fh~calc~ = the calculated structure factor amplitude from the
heavy atom model
sum is taken over the specified reflections
Ref: Cullis, A. F., Muirhead, H., Perutz, M. F., Rossmann, M. G.
& North, A. C. T. (1961). Proc. Roy. Soc. A265, 15-38.
The highest resolution for the interplanar spacing in the
reflection data used for this derivative. This is the smallest
d value.
The lowest resolution for the interplanar spacing in the
reflection data used for this derivative. This is the highest
d value.
The data set that was treated as the derivative in this
experiment.
This data item is a pointer to attribute id in category phasing_set in the
PHASING_SET category.
A description of special aspects of this derivative, its data,
its solution, or its use in phasing.
The data set that was treated as the native in this
experiment.
This data item is a pointer to attribute id in category phasing_set in the
PHASING_SET category.
The number of heavy atom sites in this derivative.
record R_cullis for each derivative.
record R_kraut obtained from all data data for each derivative.
record R_kraut obtained from acentric data for each derivative.
record R_kraut obtained from centric data for each derivative.
record figure of merit obtained from all data for
each derivative.
record figure of merit obtained from acentric data for
each derivative.
record figure of merit obtained from centric data for
each derivative.
record lack of closure obtained from all data for
each derivative.
record lack of closure obtained from acentric data for
each derivative.
record lack of closure obtained from centric data for
each derivative.
record phasing power for each derivative.
record number of reflections used for each derivative.
The mean phasing power P for acentric reflections in this
derivative.
sum|Fh~calc~^2^|
P = (----------------------------)^1/2^
sum|Fph~obs~ - Fph~calc~|^2^
Fph~obs~ = the observed structure factor amplitude of this
derivative
Fph~calc~ = the calculated structure factor amplitude of this
derivative
Fh~calc~ = the calculated structure factor amplitude from the
heavy atom model
sum is taken over the specified reflections
The mean phasing power P for centric reflections in this
derivative.
sum|Fh~calc~^2^|
P = (----------------------------)^1/2^
sum|Fph~obs~ - Fph~calc~|^2^
Fph~obs~ = the observed structure factor amplitude of the
derivative
Fph~calc~ = the calculated structure factor amplitude of the
derivative
Fh~calc~ = the calculated structure factor amplitude from the
heavy atom model
sum is taken over the specified reflections
The number of acentric reflections used in phasing for this
derivative.
The number of anomalous reflections used in phasing for this
derivative.
The number of centric reflections used in phasing for this
derivative.
Criteria used to limit the reflections used in the phasing
calculations.
> 4 \s(I)
The value of attribute id in category phasing_MIR_der must uniquely identify
a record in the PHASING_MIR_DER list.
Note that this item need not be a number; it can be any unique
identifier.
KAu(CN)2
K2HgI4_anom
K2HgI4_iso
Data items in the PHASING_MIR_DER_REFLN category record details
about the calculated structure factors obtained in an MIR
phasing experiment.
This list may contain information from a number of different
derivatives; attribute der_id in category phasing_MIR_der_refln indicates to which
derivative a given record corresponds. (A derivative in this
context does not necessarily equate with a data set; see the
definition of the PHASING_MIR_DER category for a more
thorough discussion of the meaning of derivative.)
It is not necessary for the data items describing the measured
value of F to appear in this list, as they will already have
been given in the PHASING_SET_REFLN category. However, these
items may also be listed here for completeness, if desired.
Example 1 - based on laboratory records for the (6,1,25) reflection
obtained for a Hg/Pt derivative of protein NS1.
<PDBx:phasing_MIR_der_reflnCategory>
<PDBx:phasing_MIR_der_refln index_h="6" index_k="1" index_l="25" der_id="HGPT1" set_id="NS1-96">
<PDBx:F_calc_au>106.66</PDBx:F_calc_au>
<PDBx:F_meas_au>204.67</PDBx:F_meas_au>
<PDBx:F_meas_sigma>6.21</PDBx:F_meas_sigma>
<PDBx:HL_A_iso>-3.15</PDBx:HL_A_iso>
<PDBx:HL_B_iso>-0.76</PDBx:HL_B_iso>
<PDBx:HL_C_iso>0.65</PDBx:HL_C_iso>
<PDBx:HL_D_iso>0.23</PDBx:HL_D_iso>
<PDBx:phase_calc>194.48</PDBx:phase_calc>
</PDBx:phasing_MIR_der_refln>
</PDBx:phasing_MIR_der_reflnCategory>
The calculated value of the structure factor for this derivative,
in electrons.
The calculated value of the structure factor for this derivative,
in arbitrary units.
The measured value of the structure factor for this derivative,
in electrons.
The measured value of the structure factor for this derivative,
in arbitrary units.
The estimated standard deviation of
attribute F_meas in category phasing_MIR_der_refln in electrons.
The estimated standard deviation of
attribute F_meas_au in category phasing_MIR_der_refln in arbitrary units.
The isomorphous Hendrickson-Lattman coefficient A~iso~ for this
reflection for this derivative.
-2.0 * (Fp~obs~^2^ + Fh~calc~^2^ - Fph~obs~^2^)
* Fp~obs~ * cos(alphah~calc~)
A~iso~ = -----------------------------------------------
E^2^
E = (Fph~obs~ - Fp~obs~ - Fh~calc~)^2^
for centric reflections
= [(Fph~obs~ - Fp~obs~) * 2^1/2^ - Fh~calc~]^2^
for acentric reflections
Fp~obs~ = the observed structure factor amplitude of the
native
Fph~obs~ = the observed structure factor amplitude of the
derivative
Fh~calc~ = the calculated structure factor amplitude
from the heavy atom model
alphah~calc~ = the calculated phase from the heavy atom model
The isomorphous Hendrickson-Lattman coefficient B~iso~ for this
reflection for this derivative.
-2.0 * (Fp~obs~^2^ + Fh~calc~^2^ - Fph~obs~^2^)
* Fp~obs~ * sin(alphah~calc~)
B~iso~ = -----------------------------------------------
E^2^
E = (Fph~obs~ - Fp~obs~ - Fh~calc~)^2^
for centric reflections
= [(Fph~obs~ - Fp~obs~) * 2^1/2^ - Fh~calc~]^2^
for acentric reflections
Fp~obs~ = the observed structure factor amplitude of the
native
Fph~obs~ = the observed structure factor amplitude of the
derivative
Fh~calc~ = the calculated structure factor amplitude
from the heavy atom model
alphah~calc~ = the phase calculated from the heavy atom model
The isomorphous Hendrickson-Lattman coefficient C~iso~ for this
reflection for this derivative.
-Fp~obs~^2^ * [sin(alphah~calc~)^2^
- cos(alphah~calc~)^2^]
C~iso~ = ------------------------------------
E^2^
E = (Fph~obs~ - Fp~obs~ - Fh~calc~)^2^
for centric reflections
= [(Fph~obs~ - Fp~obs~) * 2^1/2^ - Fh~calc~]^2^
for acentric reflections
Fp~obs~ = the observed structure factor amplitude of the
native
Fph~obs~ = the observed structure factor amplitude of the
derivative
Fh~calc~ = the calculated structure factor amplitude
from the heavy atom model
alphah~calc~ = the phase calculated from the heavy atom model
The isomorphous Hendrickson-Lattman coefficient D~iso~ for this
reflection for this derivative.
-2.0 * Fp~obs~^2^ * sin(alphah~calc~)^2^
* cos(alphah~calc~)^2^
D~iso~ = ----------------------------------------
E^2^
E = (Fph~obs~ - Fp~obs~ - Fh~calc~)^2^
for centric reflections
= [(Fph~obs~ - Fp~obs~) * 2^1/2^ - Fh~calc~]^2^
for acentric reflections
Fp~obs~ = the observed structure factor amplitude of the
native
Fph~obs~ = the observed structure factor amplitude of the
derivative
Fh~calc~ = the calculated structure factor amplitude
from the heavy atom model
alphah~calc~ = the phase calculated from the heavy atom model
The calculated value of the structure-factor phase, based on the
heavy atom model, for this derivative, in degrees.
Miller index h for this reflection for this derivative.
Miller index k for this reflection for this derivative.
Miller index l for this reflection for this derivative.
This data item is a pointer to attribute id in category phasing_MIR_der in the
PHASING_MIR_DER category.
This data item is a pointer to attribute id in category phasing_set in the
PHASING_SET category.
Data items in the PHASING_MIR_DER_SHELL category record
statistics, broken down into shells of resolution, for an MIR
phasing experiment.
This list may contain information from a number of different
derivatives; attribute der_id in category phasing_MIR_der_shell indicates to which
derivative a given record corresponds. (A derivative in this
context does not necessarily equate with a data set; see the
definition of the PHASING_MIR_DER category for a more
thorough discussion of the meaning of derivative.)
Example 1 - based on a paper by Zanotti et al. [(1993). J. Biol. Chem.
268, 10728-10738].
with addition of an arbitrary low-resolution limit
<PDBx:phasing_MIR_der_shellCategory>
<PDBx:phasing_MIR_der_shell der_id="KAu(CN)2" d_res_low="15.0" d_res_high="8.3">
<PDBx:ha_ampl>54</PDBx:ha_ampl>
<PDBx:loc>26</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="KAu(CN)2" d_res_low="8.3" d_res_high="6.4">
<PDBx:ha_ampl>54</PDBx:ha_ampl>
<PDBx:loc>20</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="KAu(CN)2" d_res_low="6.4" d_res_high="5.2">
<PDBx:ha_ampl>50</PDBx:ha_ampl>
<PDBx:loc>20</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="KAu(CN)2" d_res_low="5.2" d_res_high="4.4">
<PDBx:ha_ampl>44</PDBx:ha_ampl>
<PDBx:loc>23</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="KAu(CN)2" d_res_low="4.4" d_res_high="3.8">
<PDBx:ha_ampl>39</PDBx:ha_ampl>
<PDBx:loc>23</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="KAu(CN)2" d_res_low="3.8" d_res_high="3.4">
<PDBx:ha_ampl>33</PDBx:ha_ampl>
<PDBx:loc>21</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="KAu(CN)2" d_res_low="3.4" d_res_high="3.0">
<PDBx:ha_ampl>28</PDBx:ha_ampl>
<PDBx:loc>17</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="KAu(CN)2" d_res_low="15.0" d_res_high="3.0">
<PDBx:ha_ampl>38</PDBx:ha_ampl>
<PDBx:loc>21</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="K2HgI4" d_res_low="15.0" d_res_high="8.3">
<PDBx:ha_ampl>149</PDBx:ha_ampl>
<PDBx:loc>87</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="K2HgI4" d_res_low="8.3" d_res_high="6.4">
<PDBx:ha_ampl>121</PDBx:ha_ampl>
<PDBx:loc>73</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="K2HgI4" d_res_low="6.4" d_res_high="5.2">
<PDBx:ha_ampl>95</PDBx:ha_ampl>
<PDBx:loc>61</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="K2HgI4" d_res_low="5.2" d_res_high="4.4">
<PDBx:ha_ampl>80</PDBx:ha_ampl>
<PDBx:loc>60</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="K2HgI4" d_res_low="4.4" d_res_high="3.8">
<PDBx:ha_ampl>73</PDBx:ha_ampl>
<PDBx:loc>63</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="K2HgI4" d_res_low="3.8" d_res_high="3.4">
<PDBx:ha_ampl>68</PDBx:ha_ampl>
<PDBx:loc>57</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="K2HgI4" d_res_low="3.4" d_res_high="3.0">
<PDBx:ha_ampl>63</PDBx:ha_ampl>
<PDBx:loc>46</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="K2HgI4" d_res_low="15.0" d_res_high="3.0">
<PDBx:ha_ampl>79</PDBx:ha_ampl>
<PDBx:loc>58</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="K3IrCl6" d_res_low="15.0" d_res_high="8.3">
<PDBx:ha_ampl>33</PDBx:ha_ampl>
<PDBx:loc>27</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="K3IrCl6" d_res_low="8.3" d_res_high="6.4">
<PDBx:ha_ampl>40</PDBx:ha_ampl>
<PDBx:loc>23</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="K3IrCl6" d_res_low="6.4" d_res_high="5.2">
<PDBx:ha_ampl>31</PDBx:ha_ampl>
<PDBx:loc>22</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="K3IrCl6" d_res_low="5.2" d_res_high="4.4">
<PDBx:ha_ampl>27</PDBx:ha_ampl>
<PDBx:loc>23</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="K3IrCl6" d_res_low="4.4" d_res_high="3.8">
<PDBx:ha_ampl>22</PDBx:ha_ampl>
<PDBx:loc>23</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="K3IrCl6" d_res_low="3.8" d_res_high="3.4">
<PDBx:ha_ampl>19</PDBx:ha_ampl>
<PDBx:loc>20</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="K3IrCl6" d_res_low="3.4" d_res_high="3.0">
<PDBx:ha_ampl>16</PDBx:ha_ampl>
<PDBx:loc>20</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
<PDBx:phasing_MIR_der_shell der_id="K3IrCl6" d_res_low="15.0" d_res_high="3.0">
<PDBx:ha_ampl>23</PDBx:ha_ampl>
<PDBx:loc>21</PDBx:loc>
</PDBx:phasing_MIR_der_shell>
</PDBx:phasing_MIR_der_shellCategory>
Residual factor R~cullis~ for centric reflections in this
derivative in this shell.
sum| |Fph~obs~ +/- Fp~obs~| - Fh~calc~ |
R~cullis~ = ----------------------------------------
sum|Fph~obs~ - Fp~obs~|
Fp~obs~ = the observed structure factor amplitude of the native
Fph~obs~ = the observed structure factor amplitude of the
derivative
Fh~calc~ = the calculated structure factor amplitude from the
heavy atom model
sum is taken over the specified reflections
Ref: Cullis, A. F., Muirhead, H., Perutz, M. F., Rossmann, M. G.
& North, A. C. T. (1961). Proc. R. Soc. A265, 15-38.
Residual factor R~kraut~ for general reflections in this
derivative in this shell.
sum|Fph~obs~ - Fph~calc~|
R~kraut~ = -------------------------
sum|Fph~obs~|
Fph~obs~ = the observed structure factor amplitude of the
derivative
Fph~calc~ = the calculated structure factor amplitude of the
derivative
sum is taken over the specified reflections
Ref: Kraut, J., Sieker, L. C., High, D. F. & Freer, S. T.
(1962). Proc. Natl. Acad. Sci. USA, 48, 1417-14??.
The mean value of the figure of merit m for reflections for this
derivative in this shell.
int P~alpha~ exp(i*alpha) dalpha
m = --------------------------------
int P~alpha~ dalpha
P~alpha~ = the probability that phase angle alpha is correct
int is taken over the range alpha = 0 to 2 pi.
The mean heavy-atom amplitude for reflections in this
derivative in this shell.
The mean lack-of-closure error loc for reflections in this
derivative in this shell.
loc = sum|Fph~obs~ - Fph~calc~|
Fph~obs~ = the observed structure factor amplitude of the
derivative
Fph~calc~ = the calculated structure factor amplitude of the
derivative
sum is taken over the specified reflections
record R Cullis obtained from acentric data for each
derivative, but broken into resolution shells
record R Cullis obtained from centric data for each
derivative, but broken into resolution shells
record R Kraut obtained from acentric data for each
derivative, but broken into resolution shells
record R Kraut obtained from centric data for each
derivative, but broken into resolution shells
record figure of merit obtained from acentric data for each
derivative, but broken into resolution shells
record figure of merit obtained from centric data for each
derivative, but broken into resolution shells
record lack of closure obtained from acentric data for each
derivative, but broken into resolution shells
record lack of closure obtained from centric data for each
derivative, but broken into resolution shells
record phasing power obtained from acentric data for each
derivative, but broken into resolution shells
record phasing power obtained from centric data for each
derivative, but broken into resolution shells
record number of acentric reflections used for phasing for each
derivative, but broken into resolution shells
record number of centric reflections used for phasing for each
derivative, but broken into resolution shells
The mean of the phase values for reflections in this
derivative in this shell.
The mean phasing power P for reflections in this derivative
in this shell.
sum|Fh~calc~^2^|
P = (----------------------------)^1/2^
sum|Fph~obs~ - Fph~calc~|^2^
Fph~obs~ = the observed structure factor amplitude of the
derivative
Fph~calc~ = the calculated structure factor amplitude of the
derivative
Fh~calc~ = the calculated structure factor amplitude from the
heavy atom model
sum is taken over the specified reflections
The number of reflections in this shell.
This data item is a pointer to attribute id in category phasing_MIR_der in the
PHASING_MIR_DER category.
The lowest resolution for the interplanar spacing in the
reflection data for this derivative in this shell. This is the
highest d value.
The highest resolution for the interplanar spacing in the
reflection data for this derivative in this shell. This is the
smallest d value.
Data items in the PHASING_MIR_DER_SITE category record details
about the heavy-atom sites in an MIR phasing experiment.
This list may contain information from a number of different
derivatives; attribute der_id in category phasing_MIR_der_site indicates to which
derivative a given record corresponds. (A derivative in this
context does not necessarily equate with a data set; see the
definition of the PHASING_MIR_DER category for a more
thorough discussion of the meaning of derivative.)
Example 1 - based on a paper by Zanotti et al. [(1993). J. Biol. Chem.
268, 10728-10738].
with occupancies converted from electrons to fractional
<PDBx:phasing_MIR_der_siteCategory>
<PDBx:phasing_MIR_der_site der_id="KAu(CN)2" id="1">
<PDBx:atom_type_symbol>Au</PDBx:atom_type_symbol>
<PDBx:occupancy>0.40</PDBx:occupancy>
<PDBx:fract_x>0.082</PDBx:fract_x>
<PDBx:fract_y>0.266</PDBx:fract_y>
<PDBx:fract_z>0.615</PDBx:fract_z>
<PDBx:B_iso>33.0</PDBx:B_iso>
</PDBx:phasing_MIR_der_site>
<PDBx:phasing_MIR_der_site der_id="KAu(CN)2" id="2">
<PDBx:atom_type_symbol>Au</PDBx:atom_type_symbol>
<PDBx:occupancy>0.03</PDBx:occupancy>
<PDBx:fract_x>0.607</PDBx:fract_x>
<PDBx:fract_y>0.217</PDBx:fract_y>
<PDBx:fract_z>0.816</PDBx:fract_z>
<PDBx:B_iso>25.9</PDBx:B_iso>
</PDBx:phasing_MIR_der_site>
<PDBx:phasing_MIR_der_site der_id="KAu(CN)2" id="3">
<PDBx:atom_type_symbol>Au</PDBx:atom_type_symbol>
<PDBx:occupancy>0.02</PDBx:occupancy>
<PDBx:fract_x>0.263</PDBx:fract_x>
<PDBx:fract_y>0.782</PDBx:fract_y>
<PDBx:fract_z>0.906</PDBx:fract_z>
<PDBx:B_iso>15.7</PDBx:B_iso>
</PDBx:phasing_MIR_der_site>
<PDBx:phasing_MIR_der_site der_id="K2HgI4" id="1">
<PDBx:atom_type_symbol>Hg</PDBx:atom_type_symbol>
<PDBx:occupancy>0.63</PDBx:occupancy>
<PDBx:fract_x>0.048</PDBx:fract_x>
<PDBx:fract_y>0.286</PDBx:fract_y>
<PDBx:fract_z>0.636</PDBx:fract_z>
<PDBx:B_iso>33.7</PDBx:B_iso>
</PDBx:phasing_MIR_der_site>
<PDBx:phasing_MIR_der_site der_id="K2HgI4" id="2">
<PDBx:atom_type_symbol>Hg</PDBx:atom_type_symbol>
<PDBx:occupancy>0.34</PDBx:occupancy>
<PDBx:fract_x>0.913</PDBx:fract_x>
<PDBx:fract_y>0.768</PDBx:fract_y>
<PDBx:fract_z>0.889</PDBx:fract_z>
<PDBx:B_iso>36.7</PDBx:B_iso>
</PDBx:phasing_MIR_der_site>
<PDBx:phasing_MIR_der_site der_id="K2HgI4" id="3">
<PDBx:atom_type_symbol>Hg</PDBx:atom_type_symbol>
<PDBx:occupancy>0.23</PDBx:occupancy>
<PDBx:fract_x>0.974</PDBx:fract_x>
<PDBx:fract_y>0.455</PDBx:fract_y>
<PDBx:fract_z>0.974</PDBx:fract_z>
<PDBx:B_iso>24.2</PDBx:B_iso>
</PDBx:phasing_MIR_der_site>
<PDBx:phasing_MIR_der_site der_id="K2HgI4" id="4">
<PDBx:atom_type_symbol>Hg</PDBx:atom_type_symbol>
<PDBx:occupancy>0.28</PDBx:occupancy>
<PDBx:fract_x>0.903</PDBx:fract_x>
<PDBx:fract_y>0.836</PDBx:fract_y>
<PDBx:fract_z>0.859</PDBx:fract_z>
<PDBx:B_iso>14.7</PDBx:B_iso>
</PDBx:phasing_MIR_der_site>
<PDBx:phasing_MIR_der_site der_id="K2HgI4" id="5">
<PDBx:atom_type_symbol>Hg</PDBx:atom_type_symbol>
<PDBx:occupancy>0.07</PDBx:occupancy>
<PDBx:fract_x>0.489</PDBx:fract_x>
<PDBx:fract_y>0.200</PDBx:fract_y>
<PDBx:fract_z>0.885</PDBx:fract_z>
<PDBx:B_iso>6.4</PDBx:B_iso>
</PDBx:phasing_MIR_der_site>
<PDBx:phasing_MIR_der_site der_id="K2HgI4" id="6">
<PDBx:atom_type_symbol>Hg</PDBx:atom_type_symbol>
<PDBx:occupancy>0.07</PDBx:occupancy>
<PDBx:fract_x>0.162</PDBx:fract_x>
<PDBx:fract_y>0.799</PDBx:fract_y>
<PDBx:fract_z>0.889</PDBx:fract_z>
<PDBx:B_iso>32.9</PDBx:B_iso>
</PDBx:phasing_MIR_der_site>
<PDBx:phasing_MIR_der_site der_id="K3IrCl6" id="1">
<PDBx:atom_type_symbol>Ir</PDBx:atom_type_symbol>
<PDBx:occupancy>0.26</PDBx:occupancy>
<PDBx:fract_x>0.209</PDBx:fract_x>
<PDBx:fract_y>0.739</PDBx:fract_y>
<PDBx:fract_z>0.758</PDBx:fract_z>
<PDBx:B_iso>40.8</PDBx:B_iso>
</PDBx:phasing_MIR_der_site>
<PDBx:phasing_MIR_der_site der_id="K3IrCl6" id="2">
<PDBx:atom_type_symbol>Ir</PDBx:atom_type_symbol>
<PDBx:occupancy>0.05</PDBx:occupancy>
<PDBx:fract_x>0.279</PDBx:fract_x>
<PDBx:fract_y>0.613</PDBx:fract_y>
<PDBx:fract_z>0.752</PDBx:fract_z>
<PDBx:B_iso>24.9</PDBx:B_iso>
</PDBx:phasing_MIR_der_site>
</PDBx:phasing_MIR_der_siteCategory>
Isotropic temperature factor for this heavy-atom site in this
derivative.
The estimated standard deviation of attribute B_iso in category phasing_MIR_der_site.
The x coordinate of this heavy-atom position in this derivative
specified as orthogonal angstroms. The orthogonal Cartesian axes
are related to the cell axes as specified by the description
given in attribute Cartn_transform_axes in category atom_sites.
The estimated standard deviation of
attribute Cartn_x in category phasing_MIR_der_site.
The y coordinate of this heavy-atom position in this derivative
specified as orthogonal angstroms. The orthogonal Cartesian axes
are related to the cell axes as specified by the description
given in attribute Cartn_transform_axes in category atom_sites.
The estimated standard deviation of
attribute Cartn_y in category phasing_MIR_der_site.
The z coordinate of this heavy-atom position in this derivative
specified as orthogonal angstroms. The orthogonal Cartesian axes
are related to the cell axes as specified by the description
given in attribute Cartn_transform_axes in category atom_sites.
The estimated standard deviation of
attribute Cartn_z in category phasing_MIR_der_site.
This data item is a pointer to attribute symbol in category atom_type in the
ATOM_TYPE category.
The scattering factors referenced via this data item should be
those used in the refinement of the heavy atom data; in some
cases this is the scattering factor to the single heavy
atom, in others these are the scattering factors for an atomic
cluster.
A description of special aspects of the derivative site.
binds to His 117
minor site obtained from difference Fourier
same as site 2 in the K2HgI4 derivative
The x coordinate of this heavy-atom position in this derivative
specified as a fraction of attribute length_a in category cell.
The estimated standard deviation of
attribute fract_x in category phasing_MIR_der_site.
The y coordinate of this heavy-atom position in this derivative
specified as a fraction of attribute length_b in category cell.
The estimated standard deviation of
attribute fract_y in category phasing_MIR_der_site.
The z coordinate of this heavy-atom position in this derivative
specified as a fraction of attribute length_c in category cell.
The estimated standard deviation of
attribute fract_z in category phasing_MIR_der_site.
The fraction of the atom type present at this heavy-atom site
in a given derivative. The sum of the occupancies of all the
atom types at this site may not significantly exceed 1.0 unless
it is a dummy site.
The relative anomalous occupancy of the atom type
present at this heavy-atom site in a given derivative.
This atom occupancy will probably be on an arbitrary scale.
The standard uncertainty (e.s.d.) of
attribute occupancy_anom in category phasing_MIR_der_site.
The relative real isotropic occupancy of the atom type
present at this heavy-atom site in a given derivative.
This atom occupancy will probably be on an arbitrary scale.
The standard uncertainty (e.s.d.) of
attribute occupancy_iso in category phasing_MIR_der_site.
This data item is a pointer to attribute id in category phasing_MIR_der in the
PHASING_MIR_DER category.
The value of attribute id in category phasing_MIR_der_site must uniquely identify each
site in each derivative in the PHASING_MIR_DER_SITE list.
The atom identifiers need not be unique over all sites in all
derivatives; they need only be unique for each site in each
derivative.
Note that this item need not be a number; it can be any unique
identifier.
Data items in the PHASING_MIR_SHELL category record details
broken down into shells of resolution, when the phasing method
involves isomorphous replacement.
Example 1 - based on a paper by Zanotti et al. [(1993). J. Biol. Chem.
268, 10728-10738].
with addition of an arbitrary low-resolution limit
<PDBx:phasing_MIR_shellCategory>
<PDBx:phasing_MIR_shell d_res_low="15.0" d_res_high="8.3">
<PDBx:reflns>80</PDBx:reflns>
<PDBx:fom>0.69</PDBx:fom>
</PDBx:phasing_MIR_shell>
<PDBx:phasing_MIR_shell d_res_low="8.3" d_res_high="6.4">
<PDBx:reflns>184</PDBx:reflns>
<PDBx:fom>0.73</PDBx:fom>
</PDBx:phasing_MIR_shell>
<PDBx:phasing_MIR_shell d_res_low="6.4" d_res_high="5.2">
<PDBx:reflns>288</PDBx:reflns>
<PDBx:fom>0.72</PDBx:fom>
</PDBx:phasing_MIR_shell>
<PDBx:phasing_MIR_shell d_res_low="5.2" d_res_high="4.4">
<PDBx:reflns>406</PDBx:reflns>
<PDBx:fom>0.65</PDBx:fom>
</PDBx:phasing_MIR_shell>
<PDBx:phasing_MIR_shell d_res_low="4.4" d_res_high="3.8">
<PDBx:reflns>554</PDBx:reflns>
<PDBx:fom>0.54</PDBx:fom>
</PDBx:phasing_MIR_shell>
<PDBx:phasing_MIR_shell d_res_low="3.8" d_res_high="3.4">
<PDBx:reflns>730</PDBx:reflns>
<PDBx:fom>0.53</PDBx:fom>
</PDBx:phasing_MIR_shell>
<PDBx:phasing_MIR_shell d_res_low="3.4" d_res_high="3.0">
<PDBx:reflns>939</PDBx:reflns>
<PDBx:fom>0.50</PDBx:fom>
</PDBx:phasing_MIR_shell>
</PDBx:phasing_MIR_shellCategory>
The mean value of the figure of merit m for acentric reflections
in this shell.
int P~alpha~ exp(i*alpha) dalpha
m = --------------------------------
int P~alpha~ dalpha
P~a~ = the probability that phase angle a is correct
the integral is taken over the range alpha = 0 to 2 pi.
The mean value of the figure of merit m for centric reflections
in this shell.
int P~alpha~ exp(i*alpha) dalpha
m = --------------------------------
int P~alpha~ dalpha
P~a~ = the probability that phase angle a is correct
the integral is taken over the range alpha = 0 to 2 pi.
Residual factor R~cullis~ for centric reflections in this shell.
sum| |Fph~obs~ +/- Fp~obs~| - Fh~calc~ |
R~cullis~ = ----------------------------------------
sum|Fph~obs~ - Fp~obs~|
Fp~obs~ = the observed structure factor amplitude of the native
Fph~obs~ = the observed structure factor amplitude of the
derivative
Fh~calc~ = the calculated structure factor amplitude from the
heavy atom model
sum is taken over the specified reflections
Ref: Cullis, A. F., Muirhead, H., Perutz, M. F., Rossmann, M. G.
& North, A. C. T. (1961). Proc. R. Soc. A265, 15-38.
Residual factor R~kraut~ for general reflections in this shell.
sum|Fph~obs~ - Fph~calc~|
R~kraut~ = -------------------------
sum|Fph~obs~|
Fph~obs~ = the observed structure factor amplitude of the
derivative
Fph~calc~ = the calculated structure factor amplitude of the
derivative
sum is taken over the specified reflections
Ref: Kraut, J., Sieker, L. C., High, D. F. & Freer, S. T.
(1962). Proc. Natl. Acad. Sci. USA, 48, 1417-14??.
The mean value of the figure of merit m for reflections in this
shell.
int P~alpha~ exp(i*alpha) dalpha
m = --------------------------------
int P~alpha~ dalpha
P~alpha~ = the probability that phase angle alpha is correct
int is taken over the range alpha = 0 to 2 pi.
The mean lack-of-closure error loc for reflections in this shell.
loc = sum|Fph~obs~ - Fph~calc~|
Fph~obs~ = the observed structure factor amplitude of the
derivative
Fph~calc~ = the calculated structure factor amplitude of the
derivative
sum is taken over the specified reflections
The mean of the phase values for all reflections in this shell.
record R_Cullis from from acentric reflection for each shell.
record R_Cullis from from centric reflection for each shell.
record R_kraut from from acentric reflection for each shell.
record R_Kraut from from centric reflection for each shell.
record lack of closure from acentric reflection for each shell.
record lack of closure from centric reflection for each shell.
record phasing power from acentric reflection for each shell.
record phasing power from centric reflection for each shell.
The mean phasing power P for reflections in this shell.
sum|Fh~calc~^2^|
P = (----------------------------)^1/2^
sum|Fph~obs~ - Fph~calc~|^2^
Fph~obs~ = the observed structure factor amplitude of the
derivative
Fph~calc~ = the calculated structure factor amplitude of the
derivative
Fh~calc~ = the calculated structure factor amplitude from the
heavy atom model
sum is taken over the specified reflections
The number of reflections in this shell.
The number of acentric reflections in this shell.
The number of anomalous reflections in this shell.
The number of centric reflections in this shell.
The lowest resolution for the interplanar spacing in the
reflection data in this shell. This is the largest d value.
Note that the resolution limits of shells in the items
_phasing_MIR_shell.d_res_high and _phasing_MIR_shell.d_res_low
are independent of the resolution limits of shells in the items
_reflns_shell.d_res_high and _reflns_shell.d_res_low.
The highest resolution for the interplanar spacing in the
reflection data in this shell. This is the smallest d value.
Note that the resolution limits of shells in the items
_phasing_MIR_shell.d_res_high and _phasing_MIR_shell.d_res_low
are independent of the resolution limits of shells in the items
_reflns_shell.d_res_high and _reflns_shell.d_res_low.
Data items in the PHASING_AVERAGING category record details
about the phasing of the structure, when methods involving
averaging of multiple observations of the molecule in the
asymmetric unit are involved.
Example 1 - example is completely hypothetical
<PDBx:phasing_averagingCategory>
<PDBx:phasing_averaging entry_id="EXAMHYPO">
<PDBx:method> Iterative 3-fold averaging alternating with phase extensions by 0.5
reciprocal lattice units per cycle according to the method described by
X and Y (ref).</PDBx:method>
<PDBx:details> The position of the 3-fold axis was redetermined every five cycles.</PDBx:details>
</PDBx:phasing_averaging>
</PDBx:phasing_averagingCategory>
A description of special aspects of the averaging process.
A description of the phase averaging phasing method applied to
phase this structure.
Note that this is not the computer program used, which is
described in the SOFTWARE category, but rather the method
itself.
This data item should be used to describe significant
methodological options used within the phase averaging program.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the PHASING_ISOMORPHOUS category record details
about the phasing of the structure, when a model isomorphous
to the structure being phased was used to generate initial
phases.
Example 1 - based on PDB entry 4PHV and laboratory records for the
structure corresponding to PDB entry 4PHV
<PDBx:phasing_isomorphousCategory>
<PDBx:phasing_isomorphous>
<PDBx:parent>PDB entry 5HVP</PDBx:parent>
<PDBx:details> The inhibitor and all solvent atoms were removed from the parent structure
before beginning refinement. All static disorder present in the parent
structure was also removed.</PDBx:details>
</PDBx:phasing_isomorphous>
</PDBx:phasing_isomorphousCategory>
A description of special aspects of the isomorphous phasing.
Residues 13-18 were eliminated from the
starting model as it was anticipated that
binding of the inhibitor would cause a
structural rearrangement in this part of the
structure.
A description of the isomorphous phasing method applied to
phase this structure.
Note that this is not the computer program used, which is
described in the SOFTWARE category, but rather the method
itself.
This data item should be used to describe significant
methodological options used within the isomorphous phasing
program.
Iterative 3-fold averaging alternating with
phase extension by 0.5 reciprocal lattice
units per cycle according to the method
described by X and Y (ref).
Reference to the structure used to generate starting phases
if the structure referenced in this data block was phased
by virtue of being isomorphous to a known structure (e.g.
a mutant that crystallizes in the same space group as the
wild type protein.)
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the PHASING_SET category record details about
the data sets used in a phasing experiment. A given data set
may be used in a number of different ways; for instance, a
single data set could be used both as an isomorphous derivative
and as a component of a multi-wavelength calculation. This
category establishes identifiers for each data set, and permits
the archiving of a subset of experimental information for each
data set (cell constants, wavelength, temperature, etc.)
This and related categories of data items are provided so that
derivative intensity and phase information can be stored in
the same data block as the information for the refined
structure.
If it is deemed desirable to archive all possible experimental
information for each data set (raw data sets, crystal growth
conditions, etc.) those data items should be recorded in a
separate data block.
Example 1 - based on laboratory records for a Hg/Pt derivative of
protein NS1.
<PDBx:phasing_setCategory>
<PDBx:phasing_set id="NS1-96">
<PDBx:cell_angle_alpha>90.0</PDBx:cell_angle_alpha>
<PDBx:cell_angle_beta>90.0</PDBx:cell_angle_beta>
<PDBx:cell_angle_gamma>90.0</PDBx:cell_angle_gamma>
<PDBx:cell_length_a>38.63</PDBx:cell_length_a>
<PDBx:cell_length_b>38.63</PDBx:cell_length_b>
<PDBx:cell_length_c>82.88</PDBx:cell_length_c>
<PDBx:radiation_wavelength>1.5145</PDBx:radiation_wavelength>
<PDBx:detector_type>image plate</PDBx:detector_type>
<PDBx:detector_specific>RXII</PDBx:detector_specific>
</PDBx:phasing_set>
</PDBx:phasing_setCategory>
Unit-cell angle alpha in degrees of the data set.
Unit-cell angle beta in degrees of the data set.
Unit-cell angle gamma in degrees of the data set.
Unit-cell length a corresponding to the data set.
Unit-cell length b corresponding to the data set.
Unit-cell length c corresponding to the data set.
The particular radiation detector. In general this will be a
manufacturer, description, model number or some combination of
these.
Siemens model x
Kodak XG
MAR Research model y
The general class of the radiation detector.
multiwire
imaging plate
CCD
film
The particular source of radiation. In general this will be a
manufacturer, description, or model number (or some combination
of these) for laboratory sources and an institution name and
beamline name for synchrotron sources.
Rigaku RU200
Philips fine focus Mo
NSLS beamline X8C
The mean wavelength of radiation at which this data set was
measured.
The temperature in kelvins at which the data set was
measured.
The value of attribute id in category phasing_set must uniquely identify
a record in the PHASING_SET list.
Note that this item need not be a number; it can be any unique
identifier.
KAu(CN)2
K2HgI4
Data items in the PHASING_SET_REFLN category record the values
of the measured structure factors used in a phasing experiment.
This list may contain information from a number of different
data sets; attribute set_id in category phasing_set_refln indicates the data set
to which a given record corresponds.
Example 1 - based on laboratory records for a Hg/Pt derivative of
protein NS1. The example is given for the (15,15,32)
reflection.
<PDBx:phasing_set_reflnCategory>
<PDBx:phasing_set_refln set_id="NS1-96" index_h="15" index_k="15" index_l="32">
<PDBx:F_meas_au>181.79</PDBx:F_meas_au>
<PDBx:F_meas_sigma_au>3.72</PDBx:F_meas_sigma_au>
</PDBx:phasing_set_refln>
</PDBx:phasing_set_reflnCategory>
The measured value of the structure factor for this reflection
in this data set, in electrons.
The measured value of the structure factor for this reflection
in this data set, in arbitrary units.
The estimated standard deviation of attribute F_meas in category phasing_set_refln in
electrons.
The estimated standard deviation of attribute F_meas_au,
in category phasing_set_refln in arbitrary units.
Miller index h of this reflection in this data set.
Miller index k of this reflection in this data set.
Miller index l of this reflection in this data set.
This data item is a pointer to attribute id in category phasing_set in the
PHASING_SET category.
Data items in the PUBL category are used when submitting a
manuscript for publication.
Example 1 - based on data set TOZ of Willis, Beckwith & Tozer [(1991).
Acta Cryst. C47, 2276-2277].
<PDBx:publCategory>
<PDBx:publ>
<PDBx:section_title>
trans-3-Benzoyl-2-(tert-butyl)-4-(iso-butyl)-1,3-oxazolidin-5-one</PDBx:section_title>
<PDBx:section_abstract> The oxazolidinone ring is a shallow envelope
conformation with the tert-butyl and iso-butyl groups
occupying trans-positions with respect to the ring. The
angles at the N atom sum to 356.2\%, indicating a very
small degree of pyramidalization at this atom. This is
consistent with electron delocalization between the N
atom and the carbonyl centre [N-C=O = 1.374(3)\%A].</PDBx:section_abstract>
</PDBx:publ>
</PDBx:publCategory>
Example 1 - based on C~31~H~48~N~4~O~4~, reported by Coleman, Patrick,
Andersen & Rettig [(1996). Acta Cryst. C52, 1525-1527].
<PDBx:publCategory>
<PDBx:publ>
<PDBx:section_title> Hemiasterlin Methyl Ester</PDBx:section_title>
<PDBx:section_title_footnote> IUPAC name: methyl 2,5-dimethyl-4-{2-[3-methyl-
2-methylamino-3-(N-methylbenzo[b]pyrrol-
3-yl)butanamido]-3,3-dimethyl-N-methyl-
butanamido}-2-hexenoate.</PDBx:section_title_footnote>
</PDBx:publ>
</PDBx:publCategory>
The name and address of the author submitting the manuscript and
data block. This is the person contacted by the journal
editorial staff. It is preferable to use the separate data items
_publ_contact_author_name and attribute in category publ_contact_author_address.
Professor George Ferguson
Department of Chemistry and Biochemistry
University of Guelph
Ontario
Canada
N1G 2W1
The address of the author submitting the manuscript and data
block. This is the person contacted by the journal editorial
staff.
Department of Chemistry and Biochemistry
University of Guelph
Ontario
Canada
N1G 2W1
Email address in a form recognisable to international networks.
name@host.domain.country
uur5@banjo.bitnet
Facsimile telephone number of the author submitting the
manuscript and data block.
The recommended style includes the international dialing
prefix, the area code in parentheses, followed by the
local number with no spaces. The earlier convention of including
the international dialing prefixes in parentheses is no longer
recommended.
12(34)9477330
12()349477330
The name of the author submitting the manuscript and data
block. This is the person contacted by the journal editorial
staff.
Professor George Ferguson
Telephone number of the author submitting the manuscript and
data block.
The recommended style includes the international dialing
prefix, the area code in parentheses, followed by the
local number and any extension number prefixed by 'x',
with no spaces. The earlier convention of including
the international dialing prefixes in parentheses is no longer
recommended.
12(34)9477330
12()349477330
12(34)9477330x5543
A letter submitted to the journal editor by the contact author.
A description of the word processor package and computer used to
create the word processed manuscript stored as
attribute in category publ_manuscript_processed.
Tex file created by FrameMaker on a Sun 3/280
The full manuscript of a paper (excluding possibly the figures
and the tables) output in ASCII characters from a word processor.
Information about the generation of this data item must be
specified in the data item attribute in category publ_manuscript_creation.
The full manuscript of a paper (excluding figures and possibly
the tables) output as standard ASCII text.
The category of paper submitted. For submission to Acta
Crystallographica Section C, ONLY those codes indicated for use
with that journal should be used.
The name of the Co-editor whom the authors would like to
process the submitted manuscript.
The name of the journal to which the manuscript is being
submitted.
The abstract section of a manuscript if the manuscript is
submitted in parts. As an alternative see attribute manuscript_text
in category publ and attribute in category publ_manuscript_processed.
The acknowledgements section of a manuscript if the manuscript is
submitted in parts. As an alternative see attribute manuscript_text
in category publ and attribute in category publ_manuscript_processed.
The comment section of a manuscript if the manuscript is
submitted in parts. As an alternative see attribute manuscript_text
in category publ and attribute in category publ_manuscript_processed.
The discussion section of a manuscript if the manuscript is
submitted in parts. As an alternative see attribute manuscript_text
in category publ and attribute in category publ_manuscript_processed.
The experimental section of a manuscript if the manuscript is
submitted in parts. As an alternative see attribute manuscript_text
in category publ and attribute
in category publ_manuscript_processed The _publ.section_exptl_prep, _publ.section_exptl_solution and
attribute section_exptl_refinement in category publ items are preferred for
separating the chemical preparation, structure solution and
refinement aspects of the experimental description.
The experimental preparation section of a manuscript if the
manuscript is submitted in parts. As an alternative see
_publ.manuscript_text and _publ_manuscript_processed.
The experimental refinement section of a manuscript if the
manuscript is submitted in parts. As an alternative see
_publ.manuscript_text and _publ_manuscript_processed.
The experimental solution section of a manuscript if the
manuscript is submitted in parts. As an alternative see
_publ.manuscript_text and _publ_manuscript_processed.
The figure captions section of a manuscript if the manuscript is
submitted in parts. As an alternative see attribute manuscript_text
in category publ and attribute in category publ_manuscript_processed.
The introduction section of a manuscript if the manuscript is
submitted in parts. As an alternative see attribute manuscript_text
in category publ and attribute in category publ_manuscript_processed.
The references section of a manuscript if the manuscript is
submitted in parts. As an alternative see attribute manuscript_text
in category publ and attribute in category publ_manuscript_processed.
The synopsis section of a manuscript if the manuscript is
submitted in parts. As an alternative see attribute manuscript_text
in category publ and attribute in category publ_manuscript_processed.
The table legends section of a manuscript if the manuscript
is submitted in parts. As an alternative see
_publ.manuscript_text and _publ_manuscript_processed.
The title of a manuscript if the manuscript is submitted in
parts. As an alternative see attribute manuscript_text in category publ and
attribute in category publ_manuscript_processed.
The title footnote section of a manuscript if the manuscript
is submitted in parts. As an alternative see
_publ.manuscript_text and _publ_manuscript_processed.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the PUBL_AUTHOR category record details of
the authors of a manuscript submitted for publication.
Example 1 - based on data set TOZ of Willis, Beckwith & Tozer [(1991).
Acta Cryst. C47, 2276-2277].
<PDBx:publ_authorCategory>
<PDBx:publ_author name="Willis, Anthony C.">
<PDBx:address> Research School of Chemistry
Australian National University
GPO Box 4
Canberra, A.C.T.
Australia 2601</PDBx:address>
</PDBx:publ_author>
</PDBx:publ_authorCategory>
The address of a publication author. If there is more than one
author this is looped with attribute name in category publ_author.
Department
Institute
Street
City and postcode
COUNTRY
A footnote accompanying an author's name in the list of authors
of a paper. Typically indicates sabbatical address, additional
affiliations or date of decease.
On leave from U. Western Australia
Also at Department of Biophysics
The name of a publication author. If there are multiple authors
they will be looped with attribute in category publ_author_address. The family
name(s), followed by a comma and including any dynastic
components, precedes the first names or initials.
Bleary, Percival R.
O'Neil, F.K.
Van den Bossche, G.
Yang, D.-L.
Simonov, Yu.A
Data items in the PUBL_BODY category permit labelling of
different text sections within the body of a submitted paper.
Note that these should not be used in a paper which has
a standard format with sections tagged by specific data names
(such as in Acta Crystallographica Section C). Typically,
each journal will supply a list of the specific items it
requires in its Notes for Authors.
Example 1 - based on a paper by R. Restori & D. Schwarzenbach [(1996).
Acta Cryst. A52, 369-378].
<PDBx:publ_bodyCategory>
<PDBx:publ_body element="section" label="1">
<PDBx:title>Introduction</PDBx:title>
<PDBx:format>cif</PDBx:format>
<PDBx:contents> X-ray diffraction from a crystalline material provides
information on the thermally and spatially averaged
electron density in the crystal...</PDBx:contents>
</PDBx:publ_body>
<PDBx:publ_body element="section" label="2">
<PDBx:title>Theory</PDBx:title>
<PDBx:format>tex</PDBx:format>
<PDBx:contents> In the rigid-atom approximation, the dynamic electron
density of an atom is described by the convolution
product of the static atomic density and a probability
density function,
$\rho_{dyn}(\bf r) = \rho_{stat}(\bf r) * P(\bf r). \eqno(1) $</PDBx:contents>
</PDBx:publ_body>
</PDBx:publ_bodyCategory>
Example 2 - based on a paper by R. J. Papoular, Y. Vekhter & P. Coppens
(1996), Acta Cryst. A52, 397-407.
<PDBx:publ_bodyCategory>
<PDBx:publ_body element="section" label="3">
<PDBx:title> The two-channel method for retrieval of the deformation
electron density</PDBx:title>
</PDBx:publ_body>
<PDBx:publ_body element="subsection" label="3.1">
<PDBx:title>The two-channel entropy S[\D\r(r)]</PDBx:title>
<PDBx:contents> As the wide dynamic range involved in the total electron density...</PDBx:contents>
</PDBx:publ_body>
<PDBx:publ_body element="subsection" label="3.2">
<PDBx:title>Uniform vs informative prior model densities</PDBx:title>
</PDBx:publ_body>
<PDBx:publ_body element="subsubsection" label="3.2.1">
<PDBx:title>Use of uniform models</PDBx:title>
<PDBx:contents> Straightforward algebra leads to expressions analogous to...</PDBx:contents>
</PDBx:publ_body>
</PDBx:publ_bodyCategory>
A text section of a submitted paper.
Code indicating the appropriate typesetting conventions
for accented characters and special symbols in the text
section.
Title of the associated section of text.
The functional role of the associated text section.
Code identifying the section of text.
1
1.1
2.1.3
Data items in the PUBL_MANUSCRIPT_INCL category allow
the authors of a manuscript submitted for publication to list
data names that should be added to the standard request list
employed by journal printing software.
Example 1 - Example is completely hypothetical.
<PDBx:publ_manuscript_inclCategory>
<PDBx:publ_manuscript_incl>
<PDBx:extra_item>_atom_site_symmetry_multiplicity</PDBx:extra_item>
<PDBx:extra_info>to emphasise very special sites</PDBx:extra_info>
<PDBx:extra_defn>yes</PDBx:extra_defn>
</PDBx:publ_manuscript_incl>
<PDBx:publ_manuscript_incl>
<PDBx:extra_item>_chemical_compound_source</PDBx:extra_item>
<PDBx:extra_info>rare material from unusual source</PDBx:extra_info>
<PDBx:extra_defn>yes</PDBx:extra_defn>
</PDBx:publ_manuscript_incl>
<PDBx:publ_manuscript_incl>
<PDBx:extra_item>_reflns_d_resolution_high</PDBx:extra_item>
<PDBx:extra_info>the limited data is a problem here</PDBx:extra_info>
<PDBx:extra_defn>yes</PDBx:extra_defn>
</PDBx:publ_manuscript_incl>
<PDBx:publ_manuscript_incl>
<PDBx:extra_item>_crystal_magnetic_permeability</PDBx:extra_item>
<PDBx:extra_info>a new data quantity needed here</PDBx:extra_info>
<PDBx:extra_defn>no</PDBx:extra_defn>
</PDBx:publ_manuscript_incl>
</PDBx:publ_manuscript_inclCategory>
Flags whether the corresponding data item marked for inclusion
in a journal request list is a standard CIF definition or not
(flags are 'yes' or 'no').
A short note indicating the reason why the author wishes the
corresponding data item marked for inclusion in the journal
request list to be published.
to emphasise very special sites
rare material from unusual source
the limited data is a problem here
a new data quantity needed here
Specifies the inclusion of specific data into a manuscript
which is not normally requested by the journal. The values
of this item are the extra data names (which MUST be enclosed
in single quotes) that will be added to the journal request list.
_atom_site_symmetry_multiplicity
_chemical_compound_source
_reflns_d_resolution_high
_crystal_magnetic_permeability
This data item is a pointer to attribute id in category entry in the ENTRY category.
<PDBx:rcsb_columninfoCategory>
<PDBx:rcsb_columninfo tablename="summary" columnname="id">
<PDBx:description>id code</PDBx:description>
<PDBx:example>id1, id2</PDBx:example>
<PDBx:type>1</PDBx:type>
<PDBx:table_serial_no>1</PDBx:table_serial_no>
<PDBx:column_serial_no>1</PDBx:column_serial_no>
<PDBx:WWW_Selection_Criteria>1</PDBx:WWW_Selection_Criteria>
<PDBx:WWW_Report_Criteria>1</PDBx:WWW_Report_Criteria>
</PDBx:rcsb_columninfo>
</PDBx:rcsb_columninfoCategory>
SQL column visibility in WWW reports queries.
0=no, 1=yes
SQL column visibility in WWW selection querires.
0=no, 1=yes
SQL column serial number.
1,2,3,4,...
SQL column description.
Table of solvent coordinates
SQL column example.
Table of solvent coordinates
SQL table serial number.
1,2,3,4,...
SQL column type.
1:integer, 2:float, 3:string-single-left, 4:string-single-right, 5:string-multi-left,
6:string-multi-right, 7:angle, 8:boolean, 9:single character,
10:author or atom name column, 11: Date
SQL table name.
structure_summary
SQL column name.
id
<PDBx:rcsb_tableinfoCategory>
<PDBx:rcsb_tableinfo tablename="summary">
<PDBx:description>summary data</PDBx:description>
<PDBx:type>1</PDBx:type>
<PDBx:table_serial_no>1</PDBx:table_serial_no>
<PDBx:group_name>STRUCTURE</PDBx:group_name>
<PDBx:WWW_Selection_Criteria>1</PDBx:WWW_Selection_Criteria>
<PDBx:WWW_Report_Criteria>1</PDBx:WWW_Report_Criteria>
</PDBx:rcsb_tableinfo>
</PDBx:rcsb_tableinfoCategory>
SQL table visibility in WWW reports queries.
0=no, 1=yes
SQL table visibility in WWW selection querires.
0=no, 1=yes
SQL column serial number.
1,2,3,4,...
SQL table description.
Table of solvent coordinates
SQL table group name..
STRUCTURE FEATURES, SOURCE ORGANISM
SQL table serial number.
1,2,3,4,...
SQL table type.
0=general, 1=coordinate, 2=derived, 3=schema
SQL table name.
structure_summary
Data items in the REFINE category record details about the
structure refinement parameters.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:refineCategory>
<PDBx:refine entry_id="5HVP">
<PDBx:ls_number_reflns_obs>12901</PDBx:ls_number_reflns_obs>
<PDBx:ls_number_restraints>6609</PDBx:ls_number_restraints>
<PDBx:ls_number_parameters>7032</PDBx:ls_number_parameters>
<PDBx:ls_weighting_scheme>calc</PDBx:ls_weighting_scheme>
<PDBx:ls_weighting_details> Sigdel model of Konnert-Hendrickson:
Sigdel: Afsig + Bfsig*(sin(theta)/lambda-1/6)
Afsig = 22.0, Bfsig = -150.0 at the beginning of refinement.
Afsig = 15.5, Bfsig = -50.0 at the end of refinement.</PDBx:ls_weighting_details>
</PDBx:refine>
</PDBx:refineCategory>
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer [(1991).
Acta Cryst. C47, 2276-2277].
<PDBx:refineCategory>
<PDBx:refine>
<PDBx:details>sfls:_F_calc_weight_full_matrix</PDBx:details>
<PDBx:ls_structure_factor_coef>F</PDBx:ls_structure_factor_coef>
<PDBx:ls_matrix_type>full</PDBx:ls_matrix_type>
<PDBx:ls_weighting_scheme>calc w=1/(\s^2^(F)+0.0004F^2^)</PDBx:ls_weighting_scheme>
<PDBx:ls_hydrogen_treatment>refxyz except H332B noref</PDBx:ls_hydrogen_treatment>
<PDBx:ls_extinction_method>Zachariasen</PDBx:ls_extinction_method>
<PDBx:ls_extinction_coef>3514(42)</PDBx:ls_extinction_coef>
<PDBx:ls_extinction_expression>equ(22) p292 "Crystallographic Computing" (1970)</PDBx:ls_extinction_expression>
<PDBx:ls_abs_structure_details> The absolute configuration was assigned to agree with the known
chirality at C3 arising from its precursor l-leucine.</PDBx:ls_abs_structure_details>
<PDBx:ls_abs_structure_Flack>0</PDBx:ls_abs_structure_Flack>
<PDBx:ls_number_reflns_obs>1408</PDBx:ls_number_reflns_obs>
<PDBx:ls_number_parameters>272</PDBx:ls_number_parameters>
<PDBx:ls_number_restraints>0</PDBx:ls_number_restraints>
<PDBx:ls_number_constraints>0</PDBx:ls_number_constraints>
<PDBx:ls_R_factor_all>.038</PDBx:ls_R_factor_all>
<PDBx:ls_R_factor_obs>.034</PDBx:ls_R_factor_obs>
<PDBx:ls_wR_factor_all>.044</PDBx:ls_wR_factor_all>
<PDBx:ls_wR_factor_obs>.042</PDBx:ls_wR_factor_obs>
<PDBx:ls_goodness_of_fit_all>1.462</PDBx:ls_goodness_of_fit_all>
<PDBx:ls_goodness_of_fit_obs>1.515</PDBx:ls_goodness_of_fit_obs>
<PDBx:ls_shift_over_esd_max>.535</PDBx:ls_shift_over_esd_max>
<PDBx:ls_shift_over_esd_mean>.044</PDBx:ls_shift_over_esd_mean>
<PDBx:diff_density_min>-.108</PDBx:diff_density_min>
<PDBx:diff_density_max>.131</PDBx:diff_density_max>
</PDBx:refine>
</PDBx:refineCategory>
The maximum value for isotropic B value (temperature factors)
found in the coordinate set.
The mean value for isotropic B value (temperature factors)
found in the coordinate set.
The minimum value for isotropic B value (temperature factors)
found in the coordinate set.
The [1][1] element of the matrix that defines the overall
anisotropic thermal model, if one was refined for this
structure.
The [1][2] element of the matrix that defines the overall
anisotropic thermal model, if one was refined for this
structure.
The [1][3] element of the matrix that defines the overall
anisotropic thermal model, if one was refined for this
structure.
The [2][2] element of the matrix that defines the overall
anisotropic thermal model, if one was refined for this
structure.
The [2][3] element of the matrix that defines the overall
anisotropic thermal model, if one was refined for this
structure.
The [3][3] element of the matrix that defines the overall
anisotropic thermal model, if one was refined for this
structure.
The correlation coefficient between the observed and
calculated structure factors for reflections included in
the refinement.
The correlation coefficient is scale independent and gives
an idea of the quality of the refined model.
sum~i~(Fo~i~ Fc~i~ - <Fo><Fc>)
R~corr~ = ------------------------------------------------------------
SQRT{sum~i~(Fo~i~)^2^-<Fo>^2^} SQRT{sum~i~(Fc~i~)^2^-<Fc>^2^}
Fo = observed structure factors
Fc = calculated structure factors
<> = denotes average value
summation is over reflections included in the refinement
The correlation coefficient between the observed and
calculated structure factors for reflections not included
in the refinement (free reflections).
The correlation coefficient is scale independent and gives
an idea of the quality of the refined model.
sum~i~(Fo~i~ Fc~i~ - <Fo><Fc>)
R~corr~ = ------------------------------------------------------------
SQRT{sum~i~(Fo~i~)^2^-<Fo>^2^} SQRT{sum~i~(Fc~i~)^2^-<Fc>^2^}
Fo = observed structure factors
Fc = calculated structure factors
<> = denotes average value
summation is over reflections not included (free reflections)
in the refinement
Description of special aspects of the refinement process.
The maximum value of the electron density in the final difference
Fourier map.
The estimated standard deviation of attribute diff_density_max in category refine.
The minimum value of the electron density in the final difference
Fourier map.
The estimated standard deviation of attribute diff_density_min in category refine.
The root-mean-square-deviation of the electron density in the
final difference Fourier map. This value is measured with respect
to the arithmetic mean density, and is derived from summations
over each grid point in the asymmetric unit of the cell. This
quantity is useful for assessing the significance of the values
of _refine.diff_density_min and _refine.diff_density_max, and
also for defining suitable contour levels.
The estimated standard deviation of attribute diff_density_rms in category refine.
Residual factor R(Fsqd) for reflections that satisfy the
resolution limits established by attribute ls_d_res_high in category refine and
attribute ls_d_res_low in category refine and the observation limit established by
attribute observed_criterion in category reflns calculated on the squares of the
observed and calculated structure factor amplitudes.
sum|F~obs~^2^ - F~calc~^2^|
R(Fsqd) = ---------------------------
sum|F~obs~^2^|
F~obs~^2^ = squares of the observed structure factor amplitudes
F~calc~^2^ = squares of the calculated structure factor
amplitudes
sum is taken over the specified reflections
Residual factor R(I) for reflections that satisfy the
resolution limits established by attribute ls_d_res_high in category refine and
attribute ls_d_res_low in category refine and the observation limit established by
attribute observed_criterion in category reflns calculated on the estimated
reflection intensities.
This is most often calculated in Rietveld refinements of powder
data, where it is referred to as R~B~ or R~Bragg~.
sum|I~obs~ - I~calc~|
R(I) = ---------------------
sum|I~obs~|
I~obs~ = the net observed intensities
I~calc~ = the net calculated intensities
sum is taken over the specified reflections
Residual factor R for reflections that satisfy the resolution
limits established by attribute ls_d_res_high in category refine and
attribute ls_d_res_low in category refine and the observation limit established by
attribute observed_criterion in category reflns and that were used as the test
(i.e., excluded from refinement) reflections when refinement
included calculation of a "free" R factor. Details of how
reflections were assigned to the working and test sets are
given in attribute R_free_details.
in category reflns
sum|F~obs~ - F~calc~|
R = ---------------------
sum|F~obs~|
F~obs~ = the observed structure factor amplitudes
F~calc~ = the calculated structure factor amplitudes
sum is taken over the specified reflections
The estimated error in attribute ls_R_factor_R_free.
in category refine The method used to estimate the error is described in the
item attribute ls_R_factor_R_free_error_details in category refine.
Special aspects of the method used to estimated the error in
attribute ls_R_factor_R_free in category refine.
Residual factor R for reflections that satisfy the resolution
limits established by attribute ls_d_res_high in category refine and
attribute ls_d_res_low in category refine and the observation limit established by
attribute observed_criterion in category reflns and that were used as the working
(i.e., included in refinement) reflections when refinement
included calculation of a "free" R factor. Details of how
reflections were assigned to the working and test sets are
given in attribute R_free_details.
in category reflns
attribute ls_R_factor_obs in category refine should not be confused with
attribute ls_R_factor_R_work in category refine the former reports the results of a
refinement in which all observed reflections were used, the
latter a refinement in which a subset of the observed
reflections were excluded from refinement for the calculation
of a "free" R factor. However, it would be meaningful to quote
both values if a "free" R factor were calculated for most of
the refinement, but all of the observed reflections were used
in the final rounds of refinement; such a protocol should be
explained in attribute details.
in category refine
sum|F~obs~ - F~calc~|
R = ---------------------
sum|F~obs~|
F~obs~ = the observed structure factor amplitudes
F~calc~ = the calculated structure factor amplitudes
sum is taken over the specified reflections
Residual factor R for all reflections that satisfy the resolution
limits established by attribute ls_d_res_high in category refine and
attribute ls_d_res_low.
in category refine
sum|F~obs~ - F~calc~|
R = ---------------------
sum|F~obs~|
F~obs~ = the observed structure factor amplitudes
F~calc~ = the calculated structure factor amplitudes
sum is taken over the specified reflections
Residual factor R for reflections that satisfy the resolution
limits established by attribute ls_d_res_high in category refine and
attribute ls_d_res_low in category refine and the observation limit established by
attribute observed_criterion.
in category reflns
attribute ls_R_factor_obs in category refine should not be confused with
attribute ls_R_factor_R_work in category refine the former reports the results of a
refinement in which all observed reflections were used, the
latter a refinement in which a subset of the observed
reflections were excluded from refinement for the calculation
of a "free" R factor. However, it would be meaningful to quote
both values if a "free" R factor were calculated for most of
the refinement, but all of the observed reflections were used
in the final rounds of refinement; such a protocol should be
explained in attribute details.
in category refine
sum|F~obs~ - F~calc~|
R = ---------------------
sum|F~obs~|
F~obs~ = the observed structure factor amplitudes
F~calc~ = the calculated structure factor amplitudes
sum is taken over the specified reflections
The measure of absolute structure (enantiomorph or polarity) as
defined by Flack. The value must be between 0. and 1. with a
standard uncertainty (e.s.d.).
Ref: Flack, H. D. (1983). Acta Cryst. A39, 876-881.
The estimated standard deviation of
attribute ls_abs_structure_Flack in category refine.
The measure of absolute structure (enantiomorph or polarity) as
defined by Rogers.
Ref: Rogers, D. (1981). Acta Cryst. A37, 734-741.
The estimated standard deviation of
attribute ls_abs_structure_Rogers in category refine.
The nature of the absolute structure and how it was determined.
For example, it may describe the Friedel pairs used.
The highest resolution in angstroms for the interplanar spacing
in the reflection data used in refinement. This is the smallest
d value.
The lowest resolution in ansgtroms for the interplanar spacing in
the reflection data used in refinement. This is the largest d
value.
The extinction coefficient used to calculate the correction
factor applied to the structure-factor data. The nature of the
extinction coefficient is given in the definitions of
_refine_ls_extinction_expression and
attribute
in category refine_ls_extinction_method
For the 'Zachariasen' method it is the r* value; for the
'Becker-Coppens type 1 isotropic' method it is the 'g' value,
and for 'Becker-Coppens type 2 isotropic' corrections it is
the 'rho' value. Note that the magnitude of these values is
usually of the order of 10000.
Ref: Becker, P. J. & Coppens, P. (1974). Acta Cryst. A30,
129-153.
Zachariasen, W. H. (1967). Acta Cryst. 23, 558-564.
Larson, A. C. (1967). Acta Cryst. 23, 664-665.
Zachariasen coefficient r* = 0.347(5) E04
3472(52)
The estimated standard deviation of attribute ls_extinction_coef in category refine.
A description or reference of the extinction correction equation
used to apply the data item attribute ls_extinction_coef in category refine. This
information must be sufficient to reproduce the extinction
correction factors applied to the structure factors.
Equation (22) p292 "Crystallographic
Computing" Munksgaard 1970
A description of the extinction correction method applied with
the data item attribute ls_extinction_coef in category refine. This description should
include information about the correction method, either
'Becker-Coppens' or 'Zachariasen' The latter is sometimes
referred to as the 'Larson' method even though it employs
Zachariasen's formula.
The Becker-Coppens procedure is referred to as 'type 1' when
correcting secondary extinction dominated by the mosaic spread;
as 'type 2' when secondary extinction is dominated by particle
size and includes a primary extinction component; and as 'mixed'
when there is a mixture of types 1 and 2.
For the Becker-Coppens method it is also necessary to set the
mosaic distribution as either 'Gaussian' or 'Lorentzian'; and the
nature of the extinction as 'isotropic' or 'anisotropic'. Note
that if either the 'mixed' or 'anisotropic' corrections are
applied the multiple coefficients cannot be contained in
*_extinction_coef and must be listed in attribute details.
in category refine
Ref: Becker, P. J. & Coppens, P. (1974). Acta Cryst. A30,
129-153.
Zachariasen, W. H. (1967). Acta Cryst. 23, 558- 564.
Larson, A. C. (1967). Acta Cryst. 23, 664-665.
B-C type 2 Gaussian isotropic
The least-squares goodness-of-fit parameter S for all data,
after the final cycle of refinement. Ideally, account should be
taken of parameters restrained in the least squares. See also
the definition of attribute ls_restrained_S_all.
in category refine
( sum|w |Y~obs~ - Y~calc~|^2^| )^1/2^
S = ( ---------------------------- )
( N~ref~ - N~param~ )
Y~obs~ = the observed coefficients
(see attribute ls_structure_factor_coef)
in category refine Y~calc~ = the calculated coefficients
(see attribute ls_structure_factor_coef)
in category refine w = the least-squares reflection weight
[1/(e.s.d. squared)]
N~ref~ = the number of reflections used in the refinement
N~param~ = the number of refined parameters
sum is taken over the specified reflections
The estimated standard deviation of
attribute ls_goodness_of_fit_all in category refine.
The least-squares goodness-of-fit parameter S for reflection data
classified as 'observed' (see attribute observed_criterion) in category reflns after
the final cycle of refinement. Ideally, account should be taken
of parameters restrained in the least squares. See also the
definition of attribute ls_restrained_S_obs.
in category refine
( sum|w |Y~obs~ - Y~calc~|^2^| )^1/2^
S = ( ---------------------------- )
( N~ref~ - N~param~ )
Y~obs~ = the observed coefficients
(see attribute ls_structure_factor_coef)
in category refine Y~calc~ = the calculated coefficients
(see attribute ls_structure_factor_coef)
in category refine w = the least-squares reflection weight
[1/(e.s.d. squared)]
N~ref~ = the number of reflections used in the refinement
N~param~ = the number of refined parameters
sum is taken over the specified reflections
The estimated standard deviation of
attribute ls_goodness_of_fit_obs in category refine.
Treatment of hydrogen atoms in the least-squares refinement.
Type of matrix used to accumulate the least-squares derivatives.
The number of constrained (non-refined or dependent) parameters
in the least-squares process. These may be due to symmetry or any
other constraint process (e.g. rigid-body refinement). See also
_atom_site.constraints and _atom_site_refinement_flags. A general
description of constraints may appear in attribute details in category refine.
The number of parameters refined in the least-squares process.
If possible this number should include some contribution from
the restrained parameters. The restrained parameters are
distinct from the constrained parameters (where one or more
parameters are linearly dependent on the refined value of
another). Least-squares restraints often depend on geometry or
energy considerations and this makes their direct contribution
to this number, and to the goodness-of-fit calculation,
difficult to assess.
The number of reflections that satisfy the resolution limits
established by _refine.ls_d_res_high and _refine.ls_d_res_low
and the observation limit established by
attribute observed_criterion in category reflns and that were used as the test
(i.e. excluded from refinement) reflections when refinement
included calculation of a "free" R factor. Details of how
reflections were assigned to the working and test sets are
given in attribute R_free_details in category reflns.
The number of reflections that satisfy the resolution limits
established by _refine.ls_d_res_high and _refine.ls_d_res_low
and the observation limit established by
attribute observed_criterion in category reflns and that were used as the working
(i.e. included in refinement) reflections when refinement
included calculation of a "free" R factor. Details of how
reflections were assigned to the working and test sets are
given in attribute R_free_details in category reflns.
The number of reflections that satisfy the resolution limits
established by _refine.ls_d_res_high and _refine.ls_d_res_low.
The number of reflections that satisfy the resolution limits
established by _refine.ls_d_res_high and _refine.ls_d_res_low
and the observation limit established by
attribute observed_criterion in category reflns.
The number of restrained parameters. These are parameters which
are not directly dependent on another refined parameter. Often
restrained parameters involve geometry or energy dependencies.
See also _atom_site.constraints and _atom_site_refinement_flags.
A general description of refinement constraints may appear in
attribute details in category refine.
The number of reflections that satisfy the resolution limits
established by _refine.ls_d_res_high and _refine.ls_d_res_low
and the observation limit established by
attribute observed_criterion in category reflns and that were used as the test
(i.e. excluded from refinement) reflections when refinement
included calculation of a "free" R factor, espressed as a
percentage of the number of geometrically observable
reflections that satisfy the resolution limits.
The number of reflections that satisfy the resolution limits
established by _refine.ls_d_res_high and _refine.ls_d_res_low
and the observation limit established by
attribute observed_criterion in category reflns expressed as a percentage of the
number of geometrically observable reflections that satisfy
the resolution limits.
The ratio of the total number of observations of the
reflections that satisfy the resolution limits established by
_refine.ls_d_res_high and _refine.ls_d_res_low to the number
of crystallographically unique reflections that satisfy those
same limits.
The ratio of the total number of observations of the
reflections that satisfy the resolution limits established by
_refine.ls_d_res_high and _refine.ls_d_res_low and the
observation limit established by attribute observed_criterion in category reflns to
the number of crystallographically unique reflections that
satisfy those same limits.
The least-squares goodness-of-fit parameter S' for all reflection
data, after the final cycle of least squares. This parameter
explicitly includes the restraints applied in the least-squares
process. See also the definition of
attribute ls_goodness_of_fit_all.
in category refine
( sum |w |Y~obs~ - Y~calc~|^2^| )^1/2^
( + sum~r~|w~r~ |P~calc~ - P~targ~|^2^| )
S' = ( ------------------------------------- )
( N~ref~ + N~restr~ - N~param~ )
Y~obs~ = the observed coefficients
(see attribute ls_structure_factor_coef)
in category refine Y~calc~ = the observed coefficients
(see attribute ls_structure_factor_coef)
in category refine w = the least-squares reflection weight
[1/(e.s.d. squared)]
P~calc~ = the calculated restraint values
P~targ~ = the target restraint values
w~r~ = the restraint weight
N~refr~ = the number of reflections used in the refinement
(see attribute ls_number_reflns_obs)
in category refine N~restr~ = the number of restraints
(see attribute ls_number_restraints)
in category refine N~param~ = the number of refined parameters
(see attribute ls_number_parameters)
in category refine
sum is taken over the specified reflection data
sumr is taken over the restraint data
The least-squares goodness-of-fit parameter S' for reflection
data classified as observed (see attribute observed_criterion)
in category reflns after the final cycle of least squares. This parameter explicitly
includes the restraints applied in the least-squares process. See
also the definition of attribute ls_goodness_of_fit_obs.
in category refine
( sum |w |Y~obs~ - Y~calc~|^2^| )^1/2^
( + sum~r~|w~r~ |P~calc~ - P~targ~|^2^| )
S' = ( ------------------------------------- )
( N~ref~ + N~restr~ - N~param~ )
Y~obs~ = the observed coefficients
(see attribute ls_structure_factor_coef)
in category refine Y~calc~ = the observed coefficients
(see attribute ls_structure_factor_coef)
in category refine w = the least-squares reflection weight
[1/(e.s.d. squared)]
P~calc~ = the calculated restraint values
P~targ~ = the target restraint values
w~r~ = the restraint weight
N~refr~ = the number of reflections used in the refinement
(see attribute ls_number_reflns_obs)
in category refine N~restr~ = the number of restraints
(see attribute ls_number_restraints)
in category refine N~param~ = the number of refined parameters
(see attribute ls_number_parameters)
in category refine
sum is taken over the specified reflection data
sumr is taken over the restraint data
The largest ratio of the final least-squares parameter shift
divided by the final standard uncertainty (e.s.d.).
The average ratio of the final least-squares parameter shift
divided by the final standard uncertainty (e.s.d.).
Structure-factor coefficient |F|, F^2^ or I, used in the least-
squares refinement process.
Weighted residual factor wR for reflections that satisfy the
resolution limits established by attribute ls_d_res_high in category refine and
attribute ls_d_res_low in category refine and the observation limit established by
attribute observed_criterion in category reflns and that were used as the test
(i.e., excluded from refinement) reflections when refinement
included calculation of a "free" R factor. Details of how
reflections were assigned to the working and test sets are
given in attribute R_free_details.
in category reflns
( sum|w |Y~obs~ - Y~calc~|^2^| )^1/2^
wR = ( ---------------------------- )
( sum|w Y~obs~^2^| )
Y~obs~ = the observed amplitude specified by
attribute ls_structure_factor_coef
in category refine Y~calc~ = the calculated amplitude specified by
attribute ls_structure_factor_coef
in category refine w = the least squares weight
sum is taken over the specified reflections
Weighted residual factor wR for reflections that satisfy the
resolution limits established by attribute ls_d_res_high in category refine and
attribute ls_d_res_low in category refine and the observation limit established by
attribute observed_criterion in category reflns and that were used as the working
(i.e., included in refinement) reflections when refinement
included calculation of a "free" R factor. Details of how
reflections were assigned to the working and test sets are
given in attribute R_free_details.
in category reflns
( sum|w |Y~obs~ - Y~calc~|^2^| )^1/2^
wR = ( ---------------------------- )
( sum|w Y~obs~^2^| )
Y~obs~ = the observed amplitude specified by
attribute ls_structure_factor_coef
in category refine Y~calc~ = the calculated amplitude specified by
attribute ls_structure_factor_coef
in category refine w = the least squares weight
sum is taken over the specified reflections
Weighted residual factor wR for all reflections that satisfy the
resolution limits established by attribute ls_d_res_high in category refine and
attribute ls_d_res_low.
in category refine
( sum|w |Y~obs~ - Y~calc~|^2^| )^1/2^
wR = ( ---------------------------- )
( sum|w Y~obs~^2^| )
Y~obs~ = the observed amplitude specified by
attribute ls_structure_factor_coef
in category refine Y~calc~ = the calculated amplitude specified by
attribute ls_structure_factor_coef
in category refine w = the least squares weight
sum is taken over the specified reflections
Weighted residual factor wR for reflections that satisfy the
resolution limits established by attribute ls_d_res_high in category refine and
attribute ls_d_res_low in category refine and the obervation limit established by
attribute observed_criterion.
in category reflns
( sum|w |Y~obs~ - Y~calc~|^2^| )^1/2^
wR = ( ---------------------------- )
( sum|w Y~obs~^2^| )
Y~obs~ = the observed amplitude specified by
attribute ls_structure_factor_coef
in category refine Y~calc~ = the calculated amplitude specified by
attribute ls_structure_factor_coef
in category refine w = the least squares weight
sum is taken over the specified reflections
A description of special aspects of the weighting scheme used
in least-squares refinement. Used to describe the weighting
when the value of attribute ls_weighting_scheme in category refine is specified
as 'calc'.
Sigdel model of Konnert-Hendrickson:
Sigdel =
Afsig + Bfsig*(sin(theta)/lambda-1/6)
Afsig = 22.0, Bfsig = 150.0
at the beginning of refinement.
Afsig = 16.0, Bfsig = 60.0
at the end of refinement.
The weighting scheme applied in the least-squares process. The
standard code may be followed by a description of the weight
(but see _refine_ls_weighting_details for a preferred approach).
The maximum value for occupancy found in the coordinate set.
The minimum value for occupancy found in the coordinate set.
Average figure of merit of phases of reflections not included
in the refinement.
This value is derived from the likelihood function.
FOM = I_1(X)/I_0(X)
I_0, I_1 = zero- and first-order modified Bessel function
of the first kind
X = sigma_A |E_o| |E_c|/SIGMA
E_o, E_c = normalized observed and calculated structure
factors
sigma_A = <cos 2 pi s delta_x> SQRT(Sigma_P/Sigma_N)
estimated using maximum likelihood
Sigma_P = sum_{atoms in model} f^2
Sigma_N = sum_{atoms in crystal} f^2
f = form factor of atoms
delta_x = expected error
SIGMA = (sigma_{E;exp})^2 + epsilon (1-{sigma_A)^2)
sigma_{E;exp} = uncertainties of normalized observed structure
factors
epsilon = multiplicity of diffracting plane
Ref: (sigma_A estimation) "Refinement of Macromolecular
Structures by the Maximum-Likelihood Method",
Murshudov, G. N., Vagin A. A. & Dodson, E. J. (1997).
Acta Cryst. D53, 240-255.
Average figure of merit of phases of reflections included in
the refinement.
This value is derived from the likelihood function.
FOM = I_1(X)/I_0(X)
I_0, I_1 = zero- and first-order modified Bessel function
of the first kind
X = sigma_A |E_o| |E_c|/SIGMA
E_o, E_c = normalized observed and calculated structure
factors
sigma_A = <cos 2 pi s delta_x> SQRT(Sigma_P/Sigma_N)
estimated using maximum likelihood
Sigma_P = sum_{atoms in model} f^2
Sigma_N = sum_{atoms in crystal} f^2
f = is form factor of atoms
delta_x = expected error
SIGMA = (sigma_{E;exp})^2 + epsilon (1-{sigma_A)^2)
sigma_{E;exp} = uncertainties of normalized observed
structure factors
epsilon = multiplicity of diffracting plane
Ref: (sigma_A estimation) "Refinement of Macromolecular
Structures by the Maximum-Likelihood Method",
Murshudov, G. N., Vagin A. A. & Dodson, E. J. (1997).
Acta Cryst. D53, 240-255.
The overall standard uncertainty (e.s.d.) of the thermal
parameters based on a maximum likelihood residual.
The overall standard uncertainty (sigma~B~)^2 gives an idea
of the uncertainty in the B values of averagely defined
atoms (atoms with B values equal to the average B value).
N_a
(sigma~B~)^2 = 8 ----------------------------------------------
sum~i~ {(1/Sigma - (E_o)^2 (1-m^2)(SUM_AS)s^4}
SUM_AS = (sigma_A)^2/Sigma^2)
N_a = number of atoms
Sigma = (sigma_{E;exp})^2 + epsilon (1-{sigma_A)^2)
E_o = normalized structure factors
sigma_{E;exp} = experimental uncertainties of normalized
structure factors
sigma_A = <cos 2 pi s delta_x> SQRT(Sigma_P/Sigma_N)
estimated using maximum likelihood
Sigma_P = sum_{atoms in model} f^2
Sigma_N = sum_{atoms in crystal} f^2
f = is form factor of atoms
delta_x = expected error
m = is figure of merit of phases of reflection
included in summation delta_x expected error
s = reciprocal space vector
epsilon = multiplicity of diffracting plane
summation is over all reflections included in refinement
Ref: (sigma_A estimation) "Refinement of Macromolecular
Structures by the Maximum-Likelihood Method",
Murshudov, G. N., Vagin A. A. & Dodson, E. J. (1997).
Acta Cryst. D53, 240-255.
(SU ML estimation) "Simplified error estimation a la
Cruickshank in macromolecular crystallography",
Murshudov G. N. & Dodson E. J. (1997). CCP4 Newsletter,
no. 33. http://www.dl.ac.uk/CCP/CCP4/newsletter33/
The overall standard uncertainty (e.s.d.) of the positional
parameters based on a maximum likelihood residual.
The overall standard uncertainty (sigma~X~)^2 gives an
idea of the uncertainty in the position of averagely
defined atoms (atoms with B values equal to average B value)
3 N_a
(sigma~X~)^2 = -----------------------------------------------------
8 pi^2 sum~i~ {(1/Sigma - (E_o)^2 (1-m^2)(SUM_AS)s^2}
SUM_AS = (sigma_A)^2/Sigma^2)
N_a = number of atoms
Sigma = (sigma_{E;exp})^2 + epsilon (1-{sigma_A)^2)
E_o = normalized structure factors
sigma_{E;exp} = experimental uncertainties of normalized
structure factors
sigma_A = <cos 2 pi s delta_x> SQRT(Sigma_P/Sigma_N)
estimated using maximum likelihood
Sigma_P = sum_{atoms in model} f^2
Sigma_N = sum_{atoms in crystal} f^2
f = is form factor of atoms
delta_x = expected error
m = is figure of merit of phases of reflection
included in summation delta_x expected error
s = reciprocal space vector
epsilon = multiplicity of diffracting plane
summation is over all reflections included in refinement
Ref: (sigma_A estimation) "Refinement of Macromolecular
Structures by the Maximum-Likelihood Method",
Murshudov, G. N., Vagin A. A. & Dodson, E. J. (1997).
Acta Cryst. D53, 240-255.
(SU ML estimation) "Simplified error estimation a la
Cruickshank in macromolecular crystallography",
Murshudov G. N. & Dodson E. J. (1997). CCP4 Newsletter,
no. 33. http://www.dl.ac.uk/CCP/CCP4/newsletter33/
The overall standard uncertainty (e.s.d.) of the thermal
parameters based on the crystallographic R value, expressed
in a formalism known as the dispersion precision indicator
(DPI).
The overall standard uncertainty (sigma~B~) gives an idea
of the uncertainty in the B values of averagely defined
atoms (atoms with B values equal to the average B value).
N_a
(sigma_B)^2 = 0.65 --------- (R_value)^2 (D_min)^2 C^(-2/3)
(N_o-N_p)
N_a = number of atoms
N_o = number of reflections included in refinement
N_p = number of refined parameters
R_value = conventional crystallographic R-value
D_min = maximum resolution
C = completeness of data
Ref: Cruickshank, D. W. (1997). "Refinement of macromolecular
structures". Proc. CCP4 study weekend.
"Simplified error estimation a la Cruickshank in
macromolecular crystallography", Murshudov G. N. &
Dodson E. J. (1997). CCP4 Newsletter, no. 33.
http://www.dl.ac.uk/CCP/CCP4/newsletter33/
The overall standard uncertainty (e.s.d.) of the thermal
parameters based on the free R value.
The overall standard uncertainty gives an idea of the
uncertainty in the B values of averagely defined atoms
(atoms with B values equal to the average B value).
N_a
(sigma_B)^2 = 0.65 ----- (R_free)^2 (D_min)^2 C^(-2/3)
N_o
N_a = number of atoms
N_o = number of reflections included in refinement
N_p = number of refined parameters
R_free = conventional free crystallographic R-value calculated
using reflections not included in refinement
D_min = maximum resolution
C = completeness of data
Ref: Cruickshank, D. W. (1997). "Refinement of macromolecular
structures". Proc. CCP4 study weekend.
"Simplified error estimation a la Cruickshank in
macromolecular crystallography", Murshudov G. N. &
Dodson E. J. (1997). CCP4 Newsletter, no. 33.
http://www.dl.ac.uk/CCP/CCP4/newsletter33/
Details of the manner in which the cross validation
reflections were selected.
Random selection
Value of F at "high end" of data cutoff.
17600
Value of RMS |F| used as high data cutoff.
205.1
Value of F at "low end" of data cutoff.
0.30
Whether the structure was refined with indvidual
isotropic, anisotropic or overall temperature factor.
Isotropic
Overall
Whether the cross validataion method was used through
out or only at the end.
FREE R-VALUE
Data cutoff (SIGMA(F))
Data cutoff (SIGMA(I))
Method(s) used to determine the structure.
AB INITIO PHASING
Direct Methods
DM
Iterative Single wavelength Anomalous Scattering
ISAS
Iterative Single Isomorphous Replacement
ISIR
Iterative Single Isomorphous Replacement with Anomalous Scattering
ISIRAS
Multi wavelength Anomalous Diffraction
MAD
Multiple Isomorphous Replacement
MIR
Multiple Isomorphous Replacement with Anomalous Scattering
MIRAS
Molecular Replacement
MR
Single Isomorphous Replacement
SIR
Single Isomorphous Replacement with Anomalous Scattering
SIRAS
Overall estimated standard uncertainties of positional
parameters based on R value.
Overall estimated standard uncertainties of positional
parameters based on R value.
CCP4 solvent ion proble radii
CCP4 solvent shrinkage radii
CCP4 solvent proble van der Waals radii
Starting model for refinement. Starting model for
molecular replacement should refer to a previous
structure or experiment.
BDL001
Special case of stereochemistry target values used
in SHELXL refinement.
Stereochemistry target values used in refinement.
Special aspects of the solvent model used in refinement.
The value of the BSOL solvent model parameter describing
the average isotropic temperature factor of disordered
solvent atoms.
The value of the KSOL solvent model parameter describing
the ratio of electron density in the bulk solvent to the
electron density in the molecular solute.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the REFINE_B_ISO category record details about
the treatment of isotropic B (temperature) factors during
refinement.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:refine_B_isoCategory>
<PDBx:refine_B_iso class="protein">
<PDBx:treatment>isotropic</PDBx:treatment>
</PDBx:refine_B_iso>
<PDBx:refine_B_iso class="solvent">
<PDBx:treatment>isotropic</PDBx:treatment>
</PDBx:refine_B_iso>
<PDBx:refine_B_iso class="inhibitor">
<PDBx:treatment>isotropic</PDBx:treatment>
</PDBx:refine_B_iso>
</PDBx:refine_B_isoCategory>
A description of special aspects of the isotropic B (temperature)
factor refinement for the class of atoms described in
attribute class in category refine_B_iso.
The temperature factors of atoms in the side
chain of Arg 92 were held fixed due to
unstable behavior in refinement.
The treatment of isotropic B (temperature) factor refinement for
a class of atoms defined in attribute class in category refine_B_iso.
The value of the isotropic B (temperature) factor assigned to a
class of atoms defined in attribute class in category refine_B_iso. Meaningful only
for atoms with fixed isotropic B (temperature) factors.
A class of atoms treated similarly for isotropic B (temperature)
factor refinement.
all
protein
solvent
sugar-phosphate backbone
Data items in the REFINE_ANALYZE category record details
about the refined structure that are often used to analyze the
refinement and asses its quality. A given computer program
may or may not produce values corresponding to these data
names.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:refine_analyzeCategory>
<PDBx:refine_analyze entry_id="5HVP">
<PDBx:Luzzati_coordinate_error_obs>0.056</PDBx:Luzzati_coordinate_error_obs>
<PDBx:Luzzati_d_res_low_obs>2.51</PDBx:Luzzati_d_res_low_obs>
</PDBx:refine_analyze>
</PDBx:refine_analyzeCategory>
The estimated coordinate error obtain from the plot of
the R value versus sin(theta)/lambda for the reflections
treated as a test set in refinement.
Ref: Luzzati, V. (1952). Acta Cryst. 5, 134-136.
The estimated coordinate error obtained from the plot of
the R value versus sin(theta)/lambda for reflections classified
as observed.
Ref: Luzzati, V. (1952). Acta Cryst. 5, 134-136.
The value of the low resolution cutoff used in constructing the
Luzzati plot for reflections treated as a test set in
refinement.
Ref: Luzzati, V. (1952). Acta Cryst. 5, 134-136.
The value of the low resolution cutoff used in
constructing the Luzzati plot for reflections classified as
observed.
Ref: Luzzati, V. (1952). Acta Cryst. 5, 134-136.
The value of sigma~a~ used in constructing the Luzzati plot for
the reflections treated as a test set in refinement. The
details of the estimation of sigma~a~ can be specified
in attribute Luzzati_sigma_a_free_details.
in category refine_analyze
Ref: Luzzati, V. (1952). Acta Cryst. 5, 134-136.
The details of the estimation of sigma~a~ for the reflections
treated as a test set in refinement.
Ref: Luzzati, V. (1952). Acta Cryst. 5, 134-136.
The value of sigma~a~ used in constructing the Luzzati plot for
reflections classified as observed. The details of the
estimation of sigma~a~ can be specified in
attribute Luzzati_sigma_a_obs_details.
in category refine_analyze
Ref: Luzzati, V. (1952). Acta Cryst. 5, 134-136.
Special aspects of the estimation of sigma~a~ for the
reflections classified as observed.
Ref: Luzzati, V. (1952). Acta Cryst. 5, 134-136.
The value of the high-resolution cutoff in angstroms
used in calculation of the Hamilton generalized
R factor (RG) stored in refine_analyze.RG_work and
attribute RG_free.
in category refine_analyze
Ref: Hamilton, W. C. (1965). Acta Cryst. 18, 502-510.
The value of the low-resolution cutoff in angstroms
used in calculation of the Hamilton generalized
R factor (RG) stored in refine_analyze.RG_work and
attribute RG_free.
in category refine_analyze
Ref: Hamilton, W. C. (1965). Acta Cryst. 18, 502-510.
The Hamilton generalized R factor for all reflections that
satisfy the resolution limits established by
attribute RG_d_res_high in category refine_analyze and
attribute RG_d_res_low in category refine_analyze for the free R set of
reflections that were excluded from the refinement.
sum_i sum_j w_{i,j}(|Fobs|_i - G|Fcalc|_i)(|Fobs|_j - G|Fcalc|_j)
Rg = Sqrt( ----------------------------------------------------------------- )
sum_i sum_j w_{i,j} |Fobs|_i |Fobs|_j
where
|Fobs| = the observed structure factor amplitudes
|Fcalc| = the calculated structure factor amplitudes
G = the scale factor which puts |Fcalc| on the
same scale as |Fobs|
w_{i,j} = the weight for the combination of the reflections
i and j.
sum_i and sum_j are taken over the specified reflections
When the covariance of the amplitude of reflection i and
reflection j is zero (i.e. the reflections are independent)
w{i,i} can be redefined as w_i and the nested sums collapsed
into one.
sum_i w_i(|Fobs|_i - G|Fcalc|_i)^2
Rg = Sqrt( ----------------------------------- )
sum_i w_i |Fobs|_i^2
Ref: Hamilton, W. C. (1965). Acta Cryst. 18, 502-510.
The observed ratio of RGfree to RGwork. The expected RG ratio
is the value that should be achievable at the end of a structure
refinement when only random uncorrelated errors exist in data
and model provided that the observations are properly weighted.
When compared with the observed RG ratio it may indicate that a
structure has not reached convergence or a model has been
over-refined with no corresponding improvement in the model.
In an unrestrained refinement the ratio of RGfree/RGwork with
only random uncorrelated errors at convergence depends only
on the number of reflections and the number of parameters as:
sqrt[(f + m) / (f - m) ]
where f = number of included structure amplitudes and
target distances, and
m = number of parameters being refined.
In the restrained case, RGfree is calculated from a random
selection of residuals including both structure amplitudes
and restraints. When restraints are included in refinement
the RG ratio requires a term for the contribution to the
minimized residual at convergence, Drest, due to those
restraints:
Drest = r - sum (w_i . (a_i)^t . (H)^-1 a_i
where
r is the number of geometrical, temperature factor and
other restraints
H is the (m,m) normal matrix given by A^t.W.A
W is the (n,n) symmetric weight matrix of the included
observations
A is the least-squares design matrix of derivatives of
order (n,m)
a_i is the ith row of A
Then the expected RGratio becomes
sqrt [ (f + (m - r + Drest))/ (f - (m - r + Drest)) ]
The expected RGfree/RGwork is not yet included in the mmCIF
dictionary.
Ref: "Rfree and the Rfree ratio. Part I: derivation of expected
values of cross-validation residuals used in macromolecular
least-squares refinement". Tickle, I. J., Laskowski, R. A.
& Moss, D.S. (1998). Acta Cryst. D, in the press.
The Hamilton generalized R factor for all reflections
that satisfy the resolution limits established by
attribute RG_d_res_high in category refine_analyze and
attribute RG_d_res_low in category refine_analyze and for those
reflections included in the working set when a free R set
of reflections are omitted from the refinement.
sum_i sum_j w_{i,j}(|Fobs|_i - G|Fcalc|_i)(|Fobs|_j - G|Fcalc|_j)
Rg = Sqrt( ----------------------------------------------------------------- )
sum_i sum_j w_{i,j} |Fobs|_i |Fobs|_j
where
|Fobs| = the observed structure factor amplitudes
|Fcalc| = the calculated structure factor amplitudes
G = the scale factor which puts |Fcalc| on the
same scale as |Fobs|
w_{i,j} = the weight for the combination of the reflections
i and j.
sum_i and sum_j are taken over the specified reflections
When the covariance of the amplitude of reflection i and
reflection j is zero (i.e. the reflections are independent)
w{i,i} can be redefined as w_i and the nested sums collapsed
into one.
sum_i w_i(|Fobs|_i - G|Fcalc|_i)^2
Rg = Sqrt( ----------------------------------- )
sum_i w_i |Fobs|_i^2
Ref: Hamilton, W. C. (1965). Acta Cryst. 18, 502-510.
The number of discretely disorded residues in the refined model.
The sum of the occupancies of the hydrogen atoms in the refined
model.
The sum of the occupancies of the non-hydrogen atoms in the
refined model.
record the high resolution for calculating Luzzati statistics.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the REFINE_FUNCT_MINIMIZED category record
details about the individual terms of the function minimized
during refinement.
Example 1 - based on RESTRAIN refinement for the CCP4 text data set
toxd.
<PDBx:refine_funct_minimizedCategory>
<PDBx:refine_funct_minimized type="sum(W*Delta(Amplitude)^2">
<PDBx:number_terms>3009</PDBx:number_terms>
<PDBx:residual>1621.3</PDBx:residual>
</PDBx:refine_funct_minimized>
<PDBx:refine_funct_minimized type="sum(W*Delta(Plane+Rigid)^2">
<PDBx:number_terms>85</PDBx:number_terms>
<PDBx:residual>56.68</PDBx:residual>
</PDBx:refine_funct_minimized>
<PDBx:refine_funct_minimized type="sum(W*Delta(Distance)^2">
<PDBx:number_terms>1219</PDBx:number_terms>
<PDBx:residual>163.59</PDBx:residual>
</PDBx:refine_funct_minimized>
<PDBx:refine_funct_minimized type="sum(W*Delta(U-tempfactors)^2">
<PDBx:number_terms>1192</PDBx:number_terms>
<PDBx:residual>69.338</PDBx:residual>
</PDBx:refine_funct_minimized>
</PDBx:refine_funct_minimizedCategory>
The number of observations in this term. For example, if the
term is a residual of the X-ray intensities this item would
contain the number of reflections used in the refinement.
The residual for this term of the function which was minimized
in refinement.
The weight applied to this term of the function which was
minimized in the refinement.
The type of the function being minimized.
Data items in the REFINE_HIST category record details about the
various steps along the way in the refinement of the structure.
These data items are not meant to be as thorough a description
of the refinement as is provided for the final model in other
categories; rather, these data items provide a mechanism for
sketching out the progress of the refinement, supported by a
small set of representative statistics.
Example 1 - based on laboratory records for the collagen-like
peptide [(POG)4 EKG (POG)5]3.
<PDBx:refine_histCategory>
<PDBx:refine_hist cycle_id="C134">
<PDBx:d_res_high>1.85</PDBx:d_res_high>
<PDBx:d_res_low>20.0</PDBx:d_res_low>
<PDBx:number_atoms_solvent>217</PDBx:number_atoms_solvent>
<PDBx:number_atoms_total>808</PDBx:number_atoms_total>
<PDBx:number_reflns_all>6174</PDBx:number_reflns_all>
<PDBx:number_reflns_obs>4886</PDBx:number_reflns_obs>
<PDBx:number_reflns_R_free>476</PDBx:number_reflns_R_free>
<PDBx:number_reflns_R_work>4410</PDBx:number_reflns_R_work>
<PDBx:R_factor_all>.265</PDBx:R_factor_all>
<PDBx:R_factor_obs>.195</PDBx:R_factor_obs>
<PDBx:R_factor_R_free>.274</PDBx:R_factor_R_free>
<PDBx:R_factor_R_work>.160</PDBx:R_factor_R_work>
<PDBx:details>
Add majority fo solvent molecules. B factors refined by group.
Continued to remove misplaced water molecules.</PDBx:details>
</PDBx:refine_hist>
</PDBx:refine_histCategory>
Residual factor R for reflections that satisfy the resolution
limits established by attribute d_res_high in category refine_hist and
attribute d_res_low in category refine_hist and the observation limit
established by attribute observed_criterion in category reflns and that were used
as the test (i.e., excluded from refinement) reflections when
refinement included calculation of a "free" R factor. Details
of how reflections were assigned to the working and test sets
are given in attribute R_free_details.
in category reflns
sum|F~obs~ - F~calc~|
R = ---------------------
sum|F~obs~|
F~obs~ = the observed structure factor amplitudes
F~calc~ = the calculated structure factor amplitudes
sum is taken over the specified reflections
Residual factor R for reflections that satisfy the resolution
limits established by attribute d_res_high in category refine_hist and
attribute d_res_low in category refine_hist and the observation limit
established by attribute observed_criterion in category reflns and that were used
as the working (i.e., included in refinement) reflections when
refinement included calculation of a "free" R factor. Details
of how reflections were assigned to the working and test sets
are given in attribute R_free_details.
in category reflns
sum|F~obs~ - F~calc~|
R = ---------------------
sum|F~obs~|
F~obs~ = the observed structure factor amplitudes
F~calc~ = the calculated structure factor amplitudes
sum is taken over the specified reflections
Residual factor R for reflections that satisfy the resolution
limits established by attribute d_res_high in category refine_hist and
attribute d_res_low.
in category refine_hist
sum|F~obs~ - F~calc~|
R = ---------------------
sum|F~obs~|
F~obs~ = the observed structure factor amplitudes
F~calc~ = the calculated structure factor amplitudes
sum is taken over the specified reflections
Residual factor R for reflections that satisfy the resolution
limits established by attribute d_res_high in category refine_hist and
attribute d_res_low in category refine_hist and the observation criterion
established by attribute observed_criterion.
in category reflns
sum|F~obs~ - F~calc~|
R = ---------------------
sum|F~obs~|
F~obs~ = the observed structure factor amplitudes
F~calc~ = the calculated structure factor amplitudes
sum is taken over the specified reflections
The highest resolution for the interplanar spacing in the
reflection data for this cycle of refinement.
The lowest resolution for the interplanar spacing in the
reflection data for this cycle of refinement.
Description of special aspects of this cycle of the refinement
process.
Residues 13-17 fit and added to model;
substantial rebuilding of loop containing
residues 43-48; addition of first atoms to
solvent model; ten cycles of Prolsq
refinement.
The number of solvent atoms that were included in the model at
this cycle of the refinement.
The total number of atoms that were included in the model at
this cycle of the refinement.
The number of reflections that satisfy the resolution limits
established by attribute d_res_high in category refine_hist and
attribute d_res_low in category refine_hist and the observation limit
established by attribute observed_criterion in category reflns and that were used
as the test (i.e., excluded from refinement) reflections when
refinement included calculation of a "free" R factor. Details
of how reflections were assigned to the working and test sets
are given in attribute R_free_details in category reflns.
The number of reflections that satisfy the resolution limits
established by attribute d_res_high in category refine_hist and
attribute d_res_low in category refine_hist and the observation limit
established by attribute observed_criterion in category reflns and that were used
as the working (i.e., included in refinement) reflections when
refinement included calculation of a "free" R factor. Details
of how reflections were assigned to the working and test sets
are given in attribute R_free_details in category reflns.
The number of reflections that satisfy the resolution limits
established by attribute d_res_high in category refine_hist and
attribute d_res_low in category refine_hist.
The number of reflections that satisfy the resolution limits
established by attribute d_res_high in category refine_hist and
attribute d_res_low in category refine_hist and the observation criterion
established by attribute observed_criterion in category reflns.
Number of carbohydrate atoms included in refinement
Number of ligand atoms included in refinement
Number of lipid atoms included in refinement
Number of nucleic atoms included in refinement
Number of protein atoms included in refinement
Details of pseduo atoms used to model unexplained density
The value of refine_hist.cycle_id must uniquely identify a record
in the REFINE_HIST list.
Note that this item need not be a number; it can be any unique
identifier.
Data items in the REFINE_LS_RESTR category record details about
the restraints applied to various classes of parameters during
least-squares refinement.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:refine_ls_restrCategory>
<PDBx:refine_ls_restr type="bond_d">
<PDBx:dev_ideal_target>0.020</PDBx:dev_ideal_target>
<PDBx:dev_ideal>0.018</PDBx:dev_ideal>
<PDBx:number>1654</PDBx:number>
<PDBx:criterion>> 2\s</PDBx:criterion>
<PDBx:rejects>22</PDBx:rejects>
</PDBx:refine_ls_restr>
<PDBx:refine_ls_restr type="angle_d">
<PDBx:dev_ideal_target>0.030</PDBx:dev_ideal_target>
<PDBx:dev_ideal>0.038</PDBx:dev_ideal>
<PDBx:number>2246</PDBx:number>
<PDBx:criterion>> 2\s</PDBx:criterion>
<PDBx:rejects>139</PDBx:rejects>
</PDBx:refine_ls_restr>
<PDBx:refine_ls_restr type="planar_d">
<PDBx:dev_ideal_target>0.040</PDBx:dev_ideal_target>
<PDBx:dev_ideal>0.043</PDBx:dev_ideal>
<PDBx:number>498</PDBx:number>
<PDBx:criterion>> 2\s</PDBx:criterion>
<PDBx:rejects>21</PDBx:rejects>
</PDBx:refine_ls_restr>
<PDBx:refine_ls_restr type="planar">
<PDBx:dev_ideal_target>0.020</PDBx:dev_ideal_target>
<PDBx:dev_ideal>0.015</PDBx:dev_ideal>
<PDBx:number>270</PDBx:number>
<PDBx:criterion>> 2\s</PDBx:criterion>
<PDBx:rejects>1</PDBx:rejects>
</PDBx:refine_ls_restr>
<PDBx:refine_ls_restr type="chiral">
<PDBx:dev_ideal_target>0.150</PDBx:dev_ideal_target>
<PDBx:dev_ideal>0.177</PDBx:dev_ideal>
<PDBx:number>278</PDBx:number>
<PDBx:criterion>> 2\s</PDBx:criterion>
<PDBx:rejects>2</PDBx:rejects>
</PDBx:refine_ls_restr>
<PDBx:refine_ls_restr type="singtor_nbd">
<PDBx:dev_ideal_target>0.500</PDBx:dev_ideal_target>
<PDBx:dev_ideal>0.216</PDBx:dev_ideal>
<PDBx:number>582</PDBx:number>
<PDBx:criterion>> 2\s</PDBx:criterion>
<PDBx:rejects>0</PDBx:rejects>
</PDBx:refine_ls_restr>
<PDBx:refine_ls_restr type="multtor_nbd">
<PDBx:dev_ideal_target>0.500</PDBx:dev_ideal_target>
<PDBx:dev_ideal>0.207</PDBx:dev_ideal>
<PDBx:number>419</PDBx:number>
<PDBx:criterion>> 2\s</PDBx:criterion>
<PDBx:rejects>0</PDBx:rejects>
</PDBx:refine_ls_restr>
<PDBx:refine_ls_restr type="xyhbond_nbd">
<PDBx:dev_ideal_target>0.500</PDBx:dev_ideal_target>
<PDBx:dev_ideal>0.245</PDBx:dev_ideal>
<PDBx:number>149</PDBx:number>
<PDBx:criterion>> 2\s</PDBx:criterion>
<PDBx:rejects>0</PDBx:rejects>
</PDBx:refine_ls_restr>
<PDBx:refine_ls_restr type="planar_tor">
<PDBx:dev_ideal_target>3.0</PDBx:dev_ideal_target>
<PDBx:dev_ideal>2.6</PDBx:dev_ideal>
<PDBx:number>203</PDBx:number>
<PDBx:criterion>> 2\s</PDBx:criterion>
<PDBx:rejects>9</PDBx:rejects>
</PDBx:refine_ls_restr>
<PDBx:refine_ls_restr type="staggered_tor">
<PDBx:dev_ideal_target>15.0</PDBx:dev_ideal_target>
<PDBx:dev_ideal>17.4</PDBx:dev_ideal>
<PDBx:number>298</PDBx:number>
<PDBx:criterion>> 2\s</PDBx:criterion>
<PDBx:rejects>31</PDBx:rejects>
</PDBx:refine_ls_restr>
<PDBx:refine_ls_restr type="orthonormal_tor">
<PDBx:dev_ideal_target>20.0</PDBx:dev_ideal_target>
<PDBx:dev_ideal>18.1</PDBx:dev_ideal>
<PDBx:number>12</PDBx:number>
<PDBx:criterion>> 2\s</PDBx:criterion>
<PDBx:rejects>1</PDBx:rejects>
</PDBx:refine_ls_restr>
</PDBx:refine_ls_restrCategory>
A criterion used to define a parameter value that deviates
significantly from its ideal value in the model obtained by
restrained least-squares refinement.
> 3\s
For the given parameter type, the root-mean-square deviation
between the ideal values used as restraints in the least-squares
refinement and the values obtained by refinement. For instance,
bond distances may deviate by 0.018 \%A (r.m.s.) from ideal
values in current model.
For the given parameter type, the target root-mean-square
deviation between the ideal values used as restraints in the
least-squares refinement and the values obtained by refinement.
The number of parameters of this type subjected to restraint in
least-squares refinement.
The number of parameters of this type that deviate from ideal
values by more than the amount defined in
attribute criterion in category refine_ls_restr in the model obtained by restrained
least-squares refinement.
The weighting value applied to this type of restraint in
least-squares refinement.
The type of the parameter being restrained.
Explicit sets of data values are provided for the programs
PROTIN/PROLSQ (beginning with p_) and RESTRAIN (beginning with
RESTRAIN_). As computer programs will evolve, these data values
are given as examples, and not as an enumeration list. Computer
programs converting a data block to a refinement table will
expect the exact form of the data values given here to be used.
bond distance
p_bond_d
bond angle expressed as a distance
p_angle_d
planar 1,4 distance
p_planar_d
x-h bond distance
p_xhbond_d
x-h bond angle expressed as a distance
p_xhangle_d
hydrogen distance
p_hydrog_d
special distance
p_special_d
planes
p_planar
chiral centers
p_chiral
single-torsion non-bonded contact
p_singtor_nbd
multiple-torsion non-bonded contact
p_multtor_nbd
possible (x...y) hydrogen-bond
p_xyhbond_nbd
possible (x-h...y) hydrogen-bond
p_xhyhbond_nbd
special torsion angle
p_special_tor
planar torsion angle
p_planar_tor
staggered torsion angle
p_staggered_tor
orthonormal torsion angle
p_orthonormal_tor
main-chain bond isotropic thermal factor
p_mcbond_it
main-chain angle isotropic thermal factor
p_mcangle_it
side-chain bond isotropic thermal factor
p_scbond_it
side-chain angle isotropic thermal factor
p_scangle_it
x-h bond isotropic thermal factor
p_xhbond_it
x-h angle isotropic thermal factor
p_xhangle_it
special isotropic thermal factor
p_special_it
For the program RESTRAIN, the root-mean-square deviation
of the difference between the values calculated from the structures
used to compile the restraints dictionary parameters and the dictionary
values themselves in the distance range less than 2.12 Angstroms.
RESTRAIN_Distances < 2.12
For the program RESTRAIN, the root-mean-square deviation
of the difference between the values calculated from the structures
used to compile the restraints dictionary parameters and the dictionary
values themselves in the distance range 2.12 - 2.625 Angstroms.
RESTRAIN_Distances 2.12 < D < 2.625
For the program RESTRAIN, the root-mean-square deviation
of the difference between the values calculated from the structures
used to compile the restraints dictionary parameters and the dictionary
values themselves in the distance range greater than 2.625 Angstroms.
RESTRAIN_Distances > 2.625
For the program RESTRAIN, the root-mean-square deviation
of the difference between the values calculated from the structures
used to compile the restraints dictionary parameters and the dictionary
values themselves for peptide planes.
RESTRAIN_Peptide Planes
For the program RESTRAIN, the root-mean-square deviation
of the difference between the values calculated from the structures
used to compile the restraints dictionary parameters and the dictionary
values themselves for rings and planes other than peptide planes.
RESTRAIN_Ring and other planes
RESTRAIN_r.m.s. diffs for Uiso atoms at dist 1.2-1.4
RESTRAIN_r.m.s. diffs for Uiso atoms at dist 1.4-1.6
RESTRAIN_r.m.s. diffs for Uiso atoms at dist 1.8-2.0
RESTRAIN_r.m.s. diffs for Uiso atoms at dist 2.0-2.2
RESTRAIN_r.m.s. diffs for Uiso atoms at dist 2.2-2.4
RESTRAIN_r.m.s. diffs for Uiso atoms at dist >2.4
Data items in the REFINE_LS_RESTR_NCS category record details
about the restraints applied to atomic positions in domains
related by non-crystallographic symmetry during least-squares
refinement, and also about the deviation of the restrained
atomic parameters at the conclusion of refinement. It is
expected that these values will only be reported once for each
set of restrained domains.
Example 1 - based on laboratory records for the collagen-like
peptide, HYP-.
<PDBx:refine_ls_restr_ncsCategory>
<PDBx:refine_ls_restr_ncs dom_id="d2">
<PDBx:weight_position>300.0</PDBx:weight_position>
<PDBx:weight_B_iso>2.0</PDBx:weight_B_iso>
<PDBx:rms_dev_position>0.09</PDBx:rms_dev_position>
<PDBx:rms_dev_B_iso>0.16</PDBx:rms_dev_B_iso>
<PDBx:ncs_model_details>
NCS restraint for pseudo-twofold symmetry between domains
d1 and d2. Position weight coefficient given in Kcal/(mol \%A^2^)
and isotropic B weight coefficient given in \%A^2^.</PDBx:ncs_model_details>
</PDBx:refine_ls_restr_ncs>
</PDBx:refine_ls_restr_ncsCategory>
Special aspects of the manner in which non-crystallographic
restraints were applied to atomic parameters in the domain
specified by attribute dom_id in category refine_ls_restr_ncs and equivalent
atomic parameters in the domains against which it was restrained.
record the chain ID.
record the residue number .
record the standard divation between one segment to another
record the type of NCS restraint. (for example: tight positional)
record the weight used for NCS restraint.
The root-mean-square deviation in equivalent isotropic thermal
factors in the domain specified by attribute dom_id
in category refine_ls_restr_ncs and in the domains against which it was restrained.
The root-mean-square deviation in equivalent atomic positions in
the domain specified by attribute dom_id in category refine_ls_restr_ncs and in the
domains against which it was restrained.
The value of the weighting coefficient used in
non-crystallographic restraint of isotropic thermal factors in
the domain specified by attribute dom_id in category refine_ls_restr_ncs to
equivalent isotropic thermal factors in the domains against
which it was restrained.
The value of the weighting coefficient used in
non-crystallographic restraint of atomic positions in the
domain specified by attribute dom_id in category refine_ls_restr_ncs to equivalent
atomic positions in the domains against which it was restrained.
This data item is a pointer to attribute id in category struct_ncs_dom in the
STRUCT_NCS_DOM category.
Data items in the REFINE_LS_RESTR_TYPE category record details
about the restraints types used in the least-squares refinement.
Example 1 - based on RESTRAIN refinement for the CCP4 text data set
toxd.
<PDBx:refine_ls_restrCategory>
<PDBx:refine_ls_restr type="RESTRAIN_Distances < 2.12">
<PDBx:number>509</PDBx:number>
<PDBx:dev_ideal>0.005</PDBx:dev_ideal>
<PDBx:dev_ideal_target>0.022</PDBx:dev_ideal_target>
</PDBx:refine_ls_restr>
<PDBx:refine_ls_restr type="RESTRAIN_Distances 2.12 < D < 2.625">
<PDBx:number>671</PDBx:number>
<PDBx:dev_ideal>0.016</PDBx:dev_ideal>
<PDBx:dev_ideal_target>0.037</PDBx:dev_ideal_target>
</PDBx:refine_ls_restr>
<PDBx:refine_ls_restr type="RESTRAIN_Distances > 2.625">
<PDBx:number>39</PDBx:number>
<PDBx:dev_ideal>0.034</PDBx:dev_ideal>
<PDBx:dev_ideal_target>0.043</PDBx:dev_ideal_target>
</PDBx:refine_ls_restr>
<PDBx:refine_ls_restr type="RESTRAIN_Peptide Planes">
<PDBx:number>59</PDBx:number>
<PDBx:dev_ideal>0.002</PDBx:dev_ideal>
<PDBx:dev_ideal_target>0.010</PDBx:dev_ideal_target>
</PDBx:refine_ls_restr>
<PDBx:refine_ls_restr type="RESTRAIN_Ring and other planes">
<PDBx:number>26</PDBx:number>
<PDBx:dev_ideal>0.014</PDBx:dev_ideal>
<PDBx:dev_ideal_target>0.010</PDBx:dev_ideal_target>
</PDBx:refine_ls_restr>
<PDBx:refine_ls_restr type="RESTRAIN_r.m.s. diffs for Uiso atoms at dist 1.2-1.4">
<PDBx:number>212</PDBx:number>
<PDBx:dev_ideal>0.106</PDBx:dev_ideal>
</PDBx:refine_ls_restr>
<PDBx:refine_ls_restr type="RESTRAIN_r.m.s. diffs for Uiso atoms at dist 1.4-1.6">
<PDBx:number>288</PDBx:number>
<PDBx:dev_ideal>0.101</PDBx:dev_ideal>
</PDBx:refine_ls_restr>
<PDBx:refine_ls_restr type="RESTRAIN_r.m.s. diffs for Uiso atoms at dist 1.8-2.0">
<PDBx:number>6</PDBx:number>
<PDBx:dev_ideal>0.077</PDBx:dev_ideal>
</PDBx:refine_ls_restr>
<PDBx:refine_ls_restr type="RESTRAIN_r.m.s. diffs for Uiso atoms at dist 2.0-2.2">
<PDBx:number>10</PDBx:number>
<PDBx:dev_ideal>0.114</PDBx:dev_ideal>
</PDBx:refine_ls_restr>
<PDBx:refine_ls_restr type="RESTRAIN_r.m.s. diffs for Uiso atoms at dist 2.2-2.4">
<PDBx:number>215</PDBx:number>
<PDBx:dev_ideal>0.119</PDBx:dev_ideal>
</PDBx:refine_ls_restr>
<PDBx:refine_ls_restr type="RESTRAIN_r.m.s. diffs for Uiso atoms at dist >2.4">
<PDBx:number>461</PDBx:number>
<PDBx:dev_ideal>0.106</PDBx:dev_ideal>
</PDBx:refine_ls_restr>
</PDBx:refine_ls_restrCategory>
<PDBx:refine_ls_restr_typeCategory>
<PDBx:refine_ls_restr_type type="RESTRAIN_Distances < 2.12">
<PDBx:distance_cutoff_high>2.12</PDBx:distance_cutoff_high>
</PDBx:refine_ls_restr_type>
<PDBx:refine_ls_restr_type type="RESTRAIN_Distances 2.12 < D < 2.625">
<PDBx:distance_cutoff_low>2.12</PDBx:distance_cutoff_low>
<PDBx:distance_cutoff_high>2.625</PDBx:distance_cutoff_high>
</PDBx:refine_ls_restr_type>
<PDBx:refine_ls_restr_type type="RESTRAIN_Distances > 2.625">
<PDBx:distance_cutoff_low>2.625</PDBx:distance_cutoff_low>
</PDBx:refine_ls_restr_type>
<PDBx:refine_ls_restr_type type="RESTRAIN_r.m.s. diffs for Uiso atoms at dist 1.2-1.4">
<PDBx:distance_cutoff_low>1.2</PDBx:distance_cutoff_low>
<PDBx:distance_cutoff_high>1.4</PDBx:distance_cutoff_high>
</PDBx:refine_ls_restr_type>
<PDBx:refine_ls_restr_type type="RESTRAIN_r.m.s. diffs for Uiso atoms at dist 1.4-1.6">
<PDBx:distance_cutoff_low>1.4</PDBx:distance_cutoff_low>
<PDBx:distance_cutoff_high>1.6</PDBx:distance_cutoff_high>
</PDBx:refine_ls_restr_type>
<PDBx:refine_ls_restr_type type="RESTRAIN_r.m.s. diffs for Uiso atoms at dist 1.8-2.0">
<PDBx:distance_cutoff_low>1.8</PDBx:distance_cutoff_low>
<PDBx:distance_cutoff_high>2.0</PDBx:distance_cutoff_high>
</PDBx:refine_ls_restr_type>
<PDBx:refine_ls_restr_type type="RESTRAIN_r.m.s. diffs for Uiso atoms at dist 2.0-2.2">
<PDBx:distance_cutoff_low>2.0</PDBx:distance_cutoff_low>
<PDBx:distance_cutoff_high>2.2</PDBx:distance_cutoff_high>
</PDBx:refine_ls_restr_type>
<PDBx:refine_ls_restr_type type="RESTRAIN_r.m.s. diffs for Uiso atoms at dist 2.2-2.4">
<PDBx:distance_cutoff_low>2.2</PDBx:distance_cutoff_low>
<PDBx:distance_cutoff_high>2.4</PDBx:distance_cutoff_high>
</PDBx:refine_ls_restr_type>
<PDBx:refine_ls_restr_type type="RESTRAIN_r.m.s. diffs for Uiso atoms at dist >2.4">
<PDBx:distance_cutoff_low>2.4</PDBx:distance_cutoff_low>
</PDBx:refine_ls_restr_type>
</PDBx:refine_ls_restr_typeCategory>
The upper limit in angstroms of the distance range applied to
the current restraint type.
The lower limit in angstroms of the distance range applied to
the current restraint type.
This data item is a pointer to attribute type in category refine_ls_restr in the
REFINE_LS_RESTR category.
Data items in the REFINE_LS_SHELL category record details about
the results of least-squares refinement, broken out by shells of
resolution.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:refine_ls_shellCategory>
<PDBx:refine_ls_shell d_res_low="8.00" d_res_high="4.51">
<PDBx:number_reflns_obs>1226</PDBx:number_reflns_obs>
<PDBx:R_factor_obs>0.196</PDBx:R_factor_obs>
</PDBx:refine_ls_shell>
<PDBx:refine_ls_shell d_res_low="4.51" d_res_high="3.48">
<PDBx:number_reflns_obs>1679</PDBx:number_reflns_obs>
<PDBx:R_factor_obs>0.146</PDBx:R_factor_obs>
</PDBx:refine_ls_shell>
<PDBx:refine_ls_shell d_res_low="3.48" d_res_high="2.94">
<PDBx:number_reflns_obs>2014</PDBx:number_reflns_obs>
<PDBx:R_factor_obs>0.160</PDBx:R_factor_obs>
</PDBx:refine_ls_shell>
<PDBx:refine_ls_shell d_res_low="2.94" d_res_high="2.59">
<PDBx:number_reflns_obs>2147</PDBx:number_reflns_obs>
<PDBx:R_factor_obs>0.182</PDBx:R_factor_obs>
</PDBx:refine_ls_shell>
<PDBx:refine_ls_shell d_res_low="2.59" d_res_high="2.34">
<PDBx:number_reflns_obs>2127</PDBx:number_reflns_obs>
<PDBx:R_factor_obs>0.193</PDBx:R_factor_obs>
</PDBx:refine_ls_shell>
<PDBx:refine_ls_shell d_res_low="2.34" d_res_high="2.15">
<PDBx:number_reflns_obs>2061</PDBx:number_reflns_obs>
<PDBx:R_factor_obs>0.203</PDBx:R_factor_obs>
</PDBx:refine_ls_shell>
<PDBx:refine_ls_shell d_res_low="2.15" d_res_high="2.00">
<PDBx:number_reflns_obs>1647</PDBx:number_reflns_obs>
<PDBx:R_factor_obs>0.188</PDBx:R_factor_obs>
</PDBx:refine_ls_shell>
</PDBx:refine_ls_shellCategory>
Residual factor R for reflections that satisfy the resolution
limits established by attribute d_res_high in category refine_ls_shell and
attribute d_res_low in category refine_ls_shell and the observation limit
established by attribute observed_criterion in category reflns and that were used
as the test (i.e., excluded from refinement) reflections when
refinement included calculation of a "free" R factor. Details
of how reflections were assigned to the working and test sets
are given in attribute R_free_details.
in category reflns
sum|F~obs~ - F~calc~|
R = ---------------------
sum|F~obs~|
F~obs~ = the observed structure factor amplitudes
F~calc~ = the calculated structure factor amplitudes
sum is taken over the specified reflections
The estimated error in attribute R_factor_R_free.
in category refine_ls_shell The method used to estimate the error is described in the
item attribute ls_R_factor_R_free_error_details in category refine.
Residual factor R for reflections that satisfy the resolution
limits established by attribute d_res_high in category refine_ls_shell and
attribute d_res_low in category refine_ls_shell and the observation limit
established by attribute observed_criterion in category reflns and that were used
as the working (i.e., included in refinement) reflections when
refinement included calculation of a "free" R factor. Details
of how reflections were assigned to the working and test sets
are given in attribute R_free_details.
in category reflns
sum|F~obs~ - F~calc~|
R = ---------------------
sum|F~obs~|
F~obs~ = the observed structure factor amplitudes
F~calc~ = the calculated structure factor amplitudes
sum is taken over the specified reflections
Residual factor R for reflections that satisfy the resolution
limits established by attribute d_res_high in category refine_ls_shell and
attribute d_res_low.
in category refine_ls_shell
sum|F~obs~ - F~calc~|
R = ---------------------
sum|F~obs~|
F~obs~ = the observed structure factor amplitudes
F~calc~ = the calculated structure factor amplitudes
sum is taken over the specified reflections
Residual factor R for reflections that satisfy the resolution
limits established by attribute d_res_high in category refine_ls_shell and
attribute d_res_low in category refine_ls_shell and the observation criterion
established by attribute observed_criterion.
in category reflns
sum|F~obs~ - F~calc~|
R = ---------------------
sum|F~obs~|
F~obs~ = the observed structure factor amplitudes
F~calc~ = the calculated structure factor amplitudes
sum is taken over the specified reflections
The number of reflections that satisfy the resolution limits
established by attribute d_res_high in category refine_ls_shell and
attribute d_res_low in category refine_ls_shell and the observation limit
established by attribute observed_criterion in category reflns and that were used
as the test (i.e., excluded from refinement) reflections when
refinement included calculation of a "free" R factor. Details
of how reflections were assigned to the working and test sets
are given in attribute R_free_details in category reflns.
The number of reflections that satisfy the resolution limits
established by attribute d_res_high in category refine_ls_shell and
attribute d_res_low in category refine_ls_shell and the observation limit
established by attribute observed_criterion in category reflns and that were used
as the working (i.e., included in refinement) reflections when
refinement included calculation of a "free" R factor. Details
of how reflections were assigned to the working and test sets
are given in attribute R_free_details in category reflns.
The number of reflections that satisfy the resolution limits
established by attribute d_res_high in category refine_ls_shell and
attribute d_res_low in category refine_ls_shell.
The number of reflections that satisfy the resolution limits
established by attribute d_res_high in category refine_ls_shell and
attribute d_res_low in category refine_ls_shell and the observation criterion
established by attribute observed_criterion in category reflns.
Total number of bins used.
The number of reflections that satisfy the resolution limits
established by attribute d_res_high in category refine_ls_shell and
attribute d_res_low in category refine_ls_shell and the observation limit
established by attribute observed_criterion in category reflns and that were used
as the test (i.e., excluded from refinement) reflections when
refinement included calculation of a "free" R factor,
expressed as a percentage of the number of geometrically
observable reflection that satisfy the reflection limits.
The number of reflections that satisfy the resolution limits
established by attribute d_res_high in category refine_ls_shell and
attribute d_res_low in category refine_ls_shell and the observation criterion
established by attribute observed_criterion in category reflns expressed as a
percentage of the number of geometrically observable
reflections that satisfy the resolution limits.
The ratio of the total number of observations of the reflections
that satisfy the resolution limits established by
_refine_ls_shell.d_res_high and _refine_ls_shell.d_res_low
to the number of crystallographically unique reflections that
satisfy those same limits.
The ratio of the total number of observations of the
reflections that satisfy the resolution limits established by
_refine_ls_shell.d_res_high and _refine_ls_shell.d_res_low and
the observation criterion established by
attribute observed_criterion in category reflns to the number of crystallographically
unique reflections that satisfy those same limits.
Weighted residual factor wR for reflections that satisfy the
resolution limits established by attribute d_res_high
in category refine_ls_shell and attribute d_res_low in category refine_ls_shell and the observation limit
established by attribute observed_criterion in category reflns and that were used
as the test (i.e., excluded from refinement) reflections when
refinement included calculation of a "free" R factor. Details
of how reflections were assigned to the working and test sets
are given in attribute R_free_details.
in category reflns
( sum|w |Y~obs~ - Y~calc~|^2^| )^1/2^
wR = ( ---------------------------- )
( sum|w Y~obs~^2^| )
Y~obs~ = the observed amplitude specified by
attribute ls_structure_factor_coef
in category refine Y~calc~ = the calculated amplitude specified by
attribute ls_structure_factor_coef
in category refine w = the least squares weight
sum is taken over the specified reflections
Weighted residual factor wR for reflections that satisfy the
resolution limits established by attribute d_res_high
in category refine_ls_shell and attribute d_res_low in category refine_ls_shell and the observation limit
established by attribute observed_criterion in category reflns and that were used
as the working (i.e., included in refinement) reflections when
refinement included calculation of a "free" R factor. Details
of how reflections were assigned to the working and test sets
are given in attribute R_free_details.
in category reflns
( sum|w |Y~obs~ - Y~calc~|^2^| )^1/2^
wR = ( ---------------------------- )
( sum|w Y~obs~^2^| )
Y~obs~ = the observed amplitude specified by
attribute ls_structure_factor_coef
in category refine Y~calc~ = the calculated amplitude specified by
attribute ls_structure_factor_coef
in category refine w = the least squares weight
sum is taken over the specified reflections
Weighted residual factor wR for reflections that satisfy the
resolution limits established by attribute d_res_high
in category refine_ls_shell and attribute d_res_low.
in category refine_ls_shell
( sum|w |Y~obs~ - Y~calc~|^2^| )^1/2^
wR = ( ---------------------------- )
( sum|w Y~obs~^2^| )
Y~obs~ = the observed amplitude specified by
attribute ls_structure_factor_coef
in category refine Y~calc~ = the calculated amplitude specified by
attribute ls_structure_factor_coef
in category refine w = the least squares weight
sum is taken over the specified reflections
Weighted residual factor wR for reflections that satisfy the
resolution limits established by attribute d_res_high
in category refine_ls_shell and attribute d_res_low in category refine_ls_shell and the observation criterion
established by attribute observed_criterion.
in category reflns
( sum|w |Y~obs~ - Y~calc~|^2^| )^1/2^
wR = ( ---------------------------- )
( sum|w Y~obs~^2^| )
Y~obs~ = the observed amplitude specified by
attribute ls_structure_factor_coef
in category refine Y~calc~ = the calculated amplitude specified by
attribute ls_structure_factor_coef
in category refine w = the least squares weight
sum is taken over the specified reflections
The lowest resolution for the interplanar spacing in the
reflection data in this shell. This is the smallest d value.
The highest resolution for the interplanar spacing in the
reflection data in this shell. This is the largest d value.
Data items in the REFINE_OCCUPANCY category record details
about the treatment of atomic occupancies during refinement.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:refine_occupancyCategory>
<PDBx:refine_occupancy class="protein">
<PDBx:treatment>fix</PDBx:treatment>
<PDBx:value>1.00</PDBx:value>
</PDBx:refine_occupancy>
<PDBx:refine_occupancy class="solvent">
<PDBx:treatment>fix</PDBx:treatment>
<PDBx:value>1.00</PDBx:value>
</PDBx:refine_occupancy>
<PDBx:refine_occupancy class="inhibitor orientation 1">
<PDBx:treatment>fix</PDBx:treatment>
<PDBx:value>0.65</PDBx:value>
</PDBx:refine_occupancy>
<PDBx:refine_occupancy class="inhibitor orientation 2">
<PDBx:treatment>fix</PDBx:treatment>
<PDBx:value>0.35</PDBx:value>
<PDBx:details> The inhibitor binds to the enzyme in two alternative conformations. The
occupancy of each conformation was adjusted so as to result in
approximately equal mean thermal factors for the atoms in each
conformation.</PDBx:details>
</PDBx:refine_occupancy>
</PDBx:refine_occupancyCategory>
A description of special aspects of the occupancy refinement for
a class of atoms described in attribute class in category refine_occupancy.
The inhibitor binds to the enzyme in two
alternative conformations. The occupancy of
each conformation was adjusted so as to result
in approximately equal mean thermal factors
for the atoms in each conformation.
The treatment of occupancy refinement for a class of atoms
described in attribute class in category refine_occupancy.
The value of occupancy assigned to a class of atoms defined in
attribute class in category refine_occupancy. Meaningful only for atoms with fixed
occupancy.
1.0
0.41
The class of atoms treated similarly for occupancy refinement.
all
protein
solvent
sugar-phosphate backbone
Data items in the REFLN category record details about the
reflection data used to determine the ATOM_SITE data items.
The REFLN data items refer to individual reflections and must
be included in looped lists.
The REFLNS data items specify the parameters that apply to all
reflections. The REFLNS data items are not looped.
Example 1 - based on data set fetod of Todres, Yanovsky, Ermekov & Struchkov
[(1993). Acta Cryst. C49, 1352-1354].
<PDBx:reflnCategory>
<PDBx:refln index_h="2" index_k="0" index_l="0">
<PDBx:F_squared_calc>85.57</PDBx:F_squared_calc>
<PDBx:F_squared_meas>58.90</PDBx:F_squared_meas>
<PDBx:F_squared_sigma>1.45</PDBx:F_squared_sigma>
<PDBx:status>o</PDBx:status>
</PDBx:refln>
<PDBx:refln index_h="3" index_k="0" index_l="0">
<PDBx:F_squared_calc>15718.18</PDBx:F_squared_calc>
<PDBx:F_squared_meas>15631.06</PDBx:F_squared_meas>
<PDBx:F_squared_sigma>30.40</PDBx:F_squared_sigma>
<PDBx:status>o</PDBx:status>
</PDBx:refln>
<PDBx:refln index_h="4" index_k="0" index_l="0">
<PDBx:F_squared_calc>55613.11</PDBx:F_squared_calc>
<PDBx:F_squared_meas>49840.09</PDBx:F_squared_meas>
<PDBx:F_squared_sigma>61.86</PDBx:F_squared_sigma>
<PDBx:status>o</PDBx:status>
</PDBx:refln>
<PDBx:refln index_h="5" index_k="0" index_l="0">
<PDBx:F_squared_calc>246.85</PDBx:F_squared_calc>
<PDBx:F_squared_meas>241.86</PDBx:F_squared_meas>
<PDBx:F_squared_sigma>10.02</PDBx:F_squared_sigma>
<PDBx:status>o</PDBx:status>
</PDBx:refln>
<PDBx:refln index_h="6" index_k="0" index_l="0">
<PDBx:F_squared_calc>82.16</PDBx:F_squared_calc>
<PDBx:F_squared_meas>69.97</PDBx:F_squared_meas>
<PDBx:F_squared_sigma>1.93</PDBx:F_squared_sigma>
<PDBx:status>o</PDBx:status>
</PDBx:refln>
<PDBx:refln index_h="7" index_k="0" index_l="0">
<PDBx:F_squared_calc>1133.62</PDBx:F_squared_calc>
<PDBx:F_squared_meas>947.79</PDBx:F_squared_meas>
<PDBx:F_squared_sigma>11.78</PDBx:F_squared_sigma>
<PDBx:status>o</PDBx:status>
</PDBx:refln>
<PDBx:refln index_h="8" index_k="0" index_l="0">
<PDBx:F_squared_calc>2558.04</PDBx:F_squared_calc>
<PDBx:F_squared_meas>2453.33</PDBx:F_squared_meas>
<PDBx:F_squared_sigma>20.44</PDBx:F_squared_sigma>
<PDBx:status>o</PDBx:status>
</PDBx:refln>
<PDBx:refln index_h="9" index_k="0" index_l="0">
<PDBx:F_squared_calc>283.88</PDBx:F_squared_calc>
<PDBx:F_squared_meas>393.66</PDBx:F_squared_meas>
<PDBx:F_squared_sigma>7.79</PDBx:F_squared_sigma>
<PDBx:status>o</PDBx:status>
</PDBx:refln>
<PDBx:refln index_h="10" index_k="0" index_l="0">
<PDBx:F_squared_calc>283.70</PDBx:F_squared_calc>
<PDBx:F_squared_meas>171.98</PDBx:F_squared_meas>
<PDBx:F_squared_sigma>4.26</PDBx:F_squared_sigma>
<PDBx:status>o</PDBx:status>
</PDBx:refln>
</PDBx:reflnCategory>
The calculated value of structure-factor component A, in
electrons.
A = |F|cos(phase)
The calculated value of structure-factor component A, in
arbitrary units.
A = |F|cos(phase)
The measured value of structure-factor component A, in electrons.
A = |F|cos(phase)
The measured value of structure-factor component A, in
arbitrary units.
A = |F|cos(phase)
The calculated value of structure-factor component B, in
electrons.
B = |F|sin(phase)
The calculated value of structure-factor component B, in
arbitrary units.
B = |F|sin(phase)
The measured value of structure-factor component B, in electrons.
B = |F|sin(phase)
The measured value of structure-factor component B, in
arbitrary units.
B = |F|sin(phase)
The calculated value of the structure factor in electrons.
The calculated value of the structure factor in arbitrary
units.
The measured value of the structure factor in electrons.
The measured value of the structure factor in arbitrary units.
The standard uncertainty (e.s.d.) of attribute F_meas in category refln in
electrons.
The standard uncertainty (e.s.d.) of attribute F_meas_au in category refln in
arbitrary units.
The calculated value of the squared structure factor, in
electrons squared.
The measured value of the squared structure factor, in electrons
squared.
The standard uncertainty (derived from measurement) of the
squared structure factor, in electrons squared.
This data item is a pointer to attribute id in category exptl_crystal in the
EXPTL_CRYSTAL category.
The figure of merit m for this reflection.
int P~alpha~ exp(i*alpha) dalpha
m = --------------------------------
int P~alpha~ dalpha
P~a~ = the probability that phase angle a is correct
int is taken over the range alpha = 0 to 2 pi.
The calculated value of the intensity, in the measured units.
The measured value of the intensity, in the measured units.
The standard uncertainty (derived from measurement) of the
intensity, in the measured units.
Mean path length in millimetres through the crystal for this
reflection.
The calculated value of the structure factor in arbitrary
units reflecting only the contribution of the solvent model.
The calculated value of the structure factor in arbitrary
units including the contribution of the solvent model.
The calculated structure-factor phase in degrees reflecting
only the contribution of the solvent model.
The calculated structure-factor phase in degrees including
the contribution of the solvent model.
The calculated structure-factor phase in degrees.
The measured structure-factor phase in degrees.
Status of reflection in the structure refinement process.
This data item is a pointer to attribute group_code in category reflns_scale in the
REFLNS_SCALE_GROUP category.
The (sin theta)/lambda value in reciprocal angstroms for this
reflection.
Classification of a reflection so as to indicate its status with
respect to inclusion in refinement and calculation of R factors.
The symmetry reinforcement factor corresponding to the number of
times the reflection indices are generated identically from the
space-group symmetry operations.
The number of symmetry-equivalent reflections. The equivalent
reflections have the same structure-factor magnitudes because
of the space-group symmetry and the Friedel relationship.
The mean wavelength in angstroms of radiation used to measure
this reflection. This is an important parameter for data
collected using energy-dispersive detectors or the Laue
method.
This data item is a pointer to attribute wavelength_id in category diffrn_radiation in
the DIFFRN_RADIATION category.
Miller index h of the reflection. The values of the Miller
indices in the REFLN category must correspond to the cell
defined by cell lengths and cell angles in the CELL category.
Miller index k of the reflection. The values of the Miller
indices in the REFLN category must correspond to the cell
defined by cell lengths and cell angles in the CELL category.
Miller index l of the reflection. The values of the Miller
indices in the REFLN category must correspond to the cell
defined by cell lengths and cell angles in the CELL category.
Data items in the REFLN_SYS_ABS category record details about
the reflection data that should be systematically absent,
given the designated space group.
Example 1 - completely arbitrary
<PDBx:refln_sys_absCategory>
<PDBx:refln_sys_abs index_h="0" index_k="3" index_l="0">
<PDBx:I>28.32</PDBx:I>
<PDBx:sigmaI>22.95</PDBx:sigmaI>
<PDBx:I_over_sigmaI>1.23</PDBx:I_over_sigmaI>
</PDBx:refln_sys_abs>
<PDBx:refln_sys_abs index_h="0" index_k="5" index_l="0">
<PDBx:I>14.11</PDBx:I>
<PDBx:sigmaI>16.38</PDBx:sigmaI>
<PDBx:I_over_sigmaI>0.86</PDBx:I_over_sigmaI>
</PDBx:refln_sys_abs>
<PDBx:refln_sys_abs index_h="0" index_k="7" index_l="0">
<PDBx:I>114.81</PDBx:I>
<PDBx:sigmaI>20.22</PDBx:sigmaI>
<PDBx:I_over_sigmaI>5.67</PDBx:I_over_sigmaI>
</PDBx:refln_sys_abs>
<PDBx:refln_sys_abs index_h="0" index_k="9" index_l="0">
<PDBx:I>32.99</PDBx:I>
<PDBx:sigmaI>24.51</PDBx:sigmaI>
<PDBx:I_over_sigmaI>1.35</PDBx:I_over_sigmaI>
</PDBx:refln_sys_abs>
</PDBx:refln_sys_absCategory>
The measured value of the intensity in arbitrary units.
The ratio of _refln_sys_abs.I to _refln_sys_abs.sigmaI. Used
to evaluate whether a reflection that should be systematically
absent according to the designated space group is in fact
absent.
The standard uncertainty (e.s.d.) of attribute I in category refln_sys_abs in
arbitrary units.
Miller index h of the reflection. The values of the Miller
indices in the REFLN_SYS_ABS category must correspond to
the cell defined by cell lengths and cell angles in the CELL
category.
Miller index k of the reflection. The values of the Miller
indices in the REFLN_SYS_ABS category must correspond to the
cell defined by cell lengths and cell angles in the CELL
category.
Miller index l of the reflection. The values of the Miller
indices in the REFLN_SYS_ABS category must correspond to the
cell defined by cell lengths and cell angles in the CELL
category.
Data items in the REFLNS category record details about the
reflection data used to determine the ATOM_SITE data items.
The REFLN data items refer to individual reflections and must
be included in looped lists.
The REFLNS data items specify the parameters that apply to all
reflections. The REFLNS data items are not looped.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:reflnsCategory>
<PDBx:reflns entry_id="5HVP">
<PDBx:data_reduction_method> Xengen program scalei. Anomalous pairs were merged. Scaling proceeded
in several passes, beginning with 1-parameter fit and ending with
3-parameter fit.</PDBx:data_reduction_method>
<PDBx:data_reduction_details> Merging and scaling based on only those reflections with I > \s(I).</PDBx:data_reduction_details>
<PDBx:d_resolution_high>2.00</PDBx:d_resolution_high>
<PDBx:d_resolution_low>8.00</PDBx:d_resolution_low>
<PDBx:limit_h_max>22</PDBx:limit_h_max>
<PDBx:limit_h_min>0</PDBx:limit_h_min>
<PDBx:limit_k_max>46</PDBx:limit_k_max>
<PDBx:limit_k_min>0</PDBx:limit_k_min>
<PDBx:limit_l_max>57</PDBx:limit_l_max>
<PDBx:limit_l_min>0</PDBx:limit_l_min>
<PDBx:number_obs>7228</PDBx:number_obs>
<PDBx:observed_criterion>> 1 \s(I)</PDBx:observed_criterion>
<PDBx:details>none</PDBx:details>
</PDBx:reflns>
</PDBx:reflnsCategory>
Example 2 - based on data set TOZ of Willis, Beckwith & Tozer [(1991).
Acta Cryst. C47, 2276-2277].
<PDBx:reflnsCategory>
<PDBx:reflns>
<PDBx:limit_h_min>0</PDBx:limit_h_min>
<PDBx:limit_h_max>6</PDBx:limit_h_max>
<PDBx:limit_k_min>0</PDBx:limit_k_min>
<PDBx:limit_k_max>17</PDBx:limit_k_max>
<PDBx:limit_l_min>0</PDBx:limit_l_min>
<PDBx:limit_l_max>22</PDBx:limit_l_max>
<PDBx:number_all>1592</PDBx:number_all>
<PDBx:number_obs>1408</PDBx:number_obs>
<PDBx:observed_criterion>F_>_6.0_\s(F)</PDBx:observed_criterion>
<PDBx:d_resolution_high>0.8733</PDBx:d_resolution_high>
<PDBx:d_resolution_low>11.9202</PDBx:d_resolution_low>
</PDBx:reflns>
</PDBx:reflnsCategory>
The value of the overall isotropic temperature factor estimated
from the slope of the Wilson plot.
A description of the method by which a subset of reflections was
selected for exclusion from refinement so as to be used in the
calculation of a "free" R factor.
The data set was sorted with l varying most
rapidly and h varying least rapidly. Every
10th reflection is this sorted list was
excluded from refinement and included in the
calculation of a "free" R factor.
Residual factor Rmerge for all reflections that satisfy the
resolution limits established by attribute d_resolution_high in category reflns
and attribute d_resolution_low.
in category reflns
sum~i~(sum~j~|F~j~ - <F>|)
Rmerge(F) = --------------------------
sum~i~(sum~j~<F>)
F~j~ = the amplitude of the jth observation of reflection i
<F> = the mean of the amplitudes of all observations of
reflection i
sum~i~ is taken over all reflections
sum~j~ is taken over all observations of each reflection
Residual factor Rmerge for reflections that satisfy the
resolution limits established by attribute d_resolution_high
in category reflns and attribute d_resolution_low in category reflns and the observation limit
established by attribute observed_criterion.
in category reflns
sum~i~(sum~j~|F~j~ - <F>|)
Rmerge(F) = --------------------------
sum~i~(sum~j~<F>)
F~j~ = the amplitude of the jth observation of reflection i
<F> = the mean of the amplitudes of all observations of
reflection i
sum~i~ is taken over all reflections
sum~j~ is taken over all observations of each reflection
The highest resolution for the interplanar spacings in
the reflection data. This is the smallest d value.
The lowest resolution for the interplanar spacings in the
reflection data. This is the largest d value.
A description of special aspects of the data reduction
procedures.
Merging and scaling based on only those
reflections with I > sig(I).
The method used in reducing the data.
Note that this is not the computer program used, which is
described in the SOFTWARE category, but that the method
itself.
This data item should be used to describe significant
methodological options used within the data reduction programs.
Profile fitting by method of Kabsch (1987).
Scaling used spherical harmonic coefficients.
A description of reflection data not covered by the other data
names. It should include details of the Friedel pairs.
Maximum value of Miller index h for the reflection data. This
need not have the same value as attribute limit_h_max in category diffrn_reflns.
Minimum value of Miller index h for the reflection data. This
need not have the same value as attribute limit_h_min in category diffrn_reflns.
Maximum value of Miller index k for the reflection data. This
need not have the same value as attribute limit_k_max in category diffrn_reflns.
Minimum value of Miller index k for the reflection data. This
need not have the same value as attribute limit_k_min in category diffrn_reflns.
Maximum value of Miller index l for the reflection data. This
need not have the same value as attribute limit_l_max in category diffrn_reflns.
Minimum value of Miller index l for the reflection data. This
need not have the same value as attribute limit_l_min in category diffrn_reflns.
The total number of reflections in the REFLN list (not the
DIFFRN_REFLN list). This number may contain Friedel equivalent
reflections according to the nature of the structure and the
procedures used. The item attribute details in category reflns describes the
reflection data.
The number of reflections in the REFLN list (not the DIFFRN_REFLN
list) classified as observed (see attribute observed_criterion).
in category reflns This number may contain Friedel equivalent reflections according
to the nature of the structure and the procedures used.
The criterion used to classify a reflection as 'observed'. This
criterion is usually expressed in terms of a sigma(I) or
sigma(F) threshold.
>2sigma(I)
The criterion used to classify a reflection as 'observed',
expressed as a upper limit in the value of F.
The criterion used to classify a reflection as 'observed',
expressed as a lower limit in the value of F.
The criterion used to classify a reflection as 'observed',
expressed as a upper limit in the value of I.
The criterion used to classify a reflection as 'observed',
expressed as a lower limit in the value of I.
The criterion used to classify a reflection as 'observed',
expressed as a multiple of the value of sigma(F).
The criterion used to classify a reflection as 'observed',
expressed as a multiple of the value of sigma(I).
R Sym value in percent.
2.0
Overall Chi-squared statistic.
The highest optical resolution for this reflection data set
as determined by computational method attribute pdbx_d_res_opt_method in category reflns.
1.2
The lowest optical resolution for this reflection data set
as determined by computational method attribute pdbx_d_res_opt_method in category reflns.
20.5
The computational method used to determine the optical
resolution limits attribute pdbx_d_res_high_opt in category reflns and
attribute pdbx_d_res_low_opt in category reflns.
SFCHECK
Overall <I/sigma(I)>
Overall redundancy.
Number of reflections rejected in scaling operations.
The percentage of geometrically possible reflections represented
by reflections that satisfy the resolution limits established
by _reflns.d_resolution_high and _reflns.d_resolution_low and
the observation limit established by
attribute observed_criterion in category reflns.
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the REFLNS_SCALE category record details about
the structure factor scales. They are referenced from within
the REFLN list through attribute scale_group_code in category refln.
Example 1 - based on laboratory records for the collagen-like
peptide [(POG)4 EKG (POG)5]3.
<PDBx:reflns_scaleCategory>
<PDBx:reflns_scale group_code="SG1">
<PDBx:meas_F>4.0</PDBx:meas_F>
</PDBx:reflns_scale>
</PDBx:reflns_scaleCategory>
A scale associated with attribute group_code in category reflns_scale. These codes
may not correspond to those in the DIFFRN_SCALE list.
A scale associated with attribute group_code in category reflns_scale. These codes
may not correspond to those in the DIFFRN_SCALE list.
A scale associated with attribute group_code in category reflns_scale. These codes
may not correspond to those in the DIFFRN_SCALE list.
The code identifying a scale attribute meas_F in category reflns_scale
_reflns_scale.meas_F_squared or _reflns_scale.meas_intensity.
These are linked to the REFLN list by the
attribute scale_group_code in category refln.
1
2
c1
c2
Data items in the REFLNS_SHELL category record details about
the reflection data used to determine the ATOM_SITE data items,
as broken down by shells of resolution.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:reflns_shellCategory>
<PDBx:reflns_shell d_res_high="31.38" d_res_low="3.82">
<PDBx:meanI_over_sigI_obs>69.8</PDBx:meanI_over_sigI_obs>
<PDBx:number_measured_obs>9024</PDBx:number_measured_obs>
<PDBx:number_unique_obs>2540</PDBx:number_unique_obs>
<PDBx:percent_possible_obs>96.8</PDBx:percent_possible_obs>
<PDBx:Rmerge_F_obs>1.98</PDBx:Rmerge_F_obs>
</PDBx:reflns_shell>
<PDBx:reflns_shell d_res_high="3.82" d_res_low="3.03">
<PDBx:meanI_over_sigI_obs>26.1</PDBx:meanI_over_sigI_obs>
<PDBx:number_measured_obs>7413</PDBx:number_measured_obs>
<PDBx:number_unique_obs>2364</PDBx:number_unique_obs>
<PDBx:percent_possible_obs>95.1</PDBx:percent_possible_obs>
<PDBx:Rmerge_F_obs>3.85</PDBx:Rmerge_F_obs>
</PDBx:reflns_shell>
<PDBx:reflns_shell d_res_high="3.03" d_res_low="2.65">
<PDBx:meanI_over_sigI_obs>10.5</PDBx:meanI_over_sigI_obs>
<PDBx:number_measured_obs>5640</PDBx:number_measured_obs>
<PDBx:number_unique_obs>2123</PDBx:number_unique_obs>
<PDBx:percent_possible_obs>86.2</PDBx:percent_possible_obs>
<PDBx:Rmerge_F_obs>6.37</PDBx:Rmerge_F_obs>
</PDBx:reflns_shell>
<PDBx:reflns_shell d_res_high="2.65" d_res_low="2.41">
<PDBx:meanI_over_sigI_obs>6.4</PDBx:meanI_over_sigI_obs>
<PDBx:number_measured_obs>4322</PDBx:number_measured_obs>
<PDBx:number_unique_obs>1882</PDBx:number_unique_obs>
<PDBx:percent_possible_obs>76.8</PDBx:percent_possible_obs>
<PDBx:Rmerge_F_obs>8.01</PDBx:Rmerge_F_obs>
</PDBx:reflns_shell>
<PDBx:reflns_shell d_res_high="2.41" d_res_low="2.23">
<PDBx:meanI_over_sigI_obs>4.3</PDBx:meanI_over_sigI_obs>
<PDBx:number_measured_obs>3247</PDBx:number_measured_obs>
<PDBx:number_unique_obs>1714</PDBx:number_unique_obs>
<PDBx:percent_possible_obs>70.4</PDBx:percent_possible_obs>
<PDBx:Rmerge_F_obs>9.86</PDBx:Rmerge_F_obs>
</PDBx:reflns_shell>
<PDBx:reflns_shell d_res_high="2.23" d_res_low="2.10">
<PDBx:meanI_over_sigI_obs>3.1</PDBx:meanI_over_sigI_obs>
<PDBx:number_measured_obs>1140</PDBx:number_measured_obs>
<PDBx:number_unique_obs>812</PDBx:number_unique_obs>
<PDBx:percent_possible_obs>33.3</PDBx:percent_possible_obs>
<PDBx:Rmerge_F_obs>13.99</PDBx:Rmerge_F_obs>
</PDBx:reflns_shell>
</PDBx:reflns_shellCategory>
Residual factor Rmerge for all reflections that satisfy the
resolution limits established by attribute d_res_high in category reflns_shell and
attribute d_res_low.
in category reflns_shell
sum~i~(sum~j~|F~j~ - <F>|)
Rmerge(F) = --------------------------
sum~i~(sum~j~<F>)
F~j~ = the amplitude of the jth observation of reflection i
<F> = the mean of the amplitudes of all observations of
reflection i
sum~i~ is taken over all reflections
sum~j~ is taken over all observations of each reflection
Residual factor Rmerge for reflections that satisfy the
resolution limits established by attribute d_res_high in category reflns_shell and
attribute d_res_low in category reflns_shell and the observation criterion
established by attribute observed_criterion.
in category reflns
sum~i~(sum~j~|F~j~ - <F>|)
Rmerge(F) = --------------------------
sum~i~(sum~j~<F>)
F~j~ = the amplitude of the jth observation of reflection i
<F> = the mean of the amplitudes of all observations of
reflection i
sum~i~ is taken over all reflections
sum~j~ is taken over all observations of each reflection
The value of Rmerge(I) for all reflections in a given shell.
sum~i~(sum~j~|I~j~ - <I>|)
Rmerge(I) = --------------------------
sum~i~(sum~j~<I>)
I~j~ = the intensity of the jth observation of reflection i
<I> = the mean of the intensities of all observations of
reflection i
sum~i~ is taken over all reflections
sum~j~ is taken over all observations of each reflection
The value of Rmerge(I) for reflections classified as 'observed'
(see attribute observed_criterion) in category reflns in a given shell.
sum~i~(sum~j~|I~j~ - <I>|)
Rmerge(I) = --------------------------
sum~i~(sum~j~<I>)
I~j~ = the intensity of the jth observation of reflection i
<I> = the mean of the intensities of all observations of
reflection i
sum~i~ is taken over all reflections
sum~j~ is taken over all observations of each reflection
The ratio of the mean of the intensities of all reflections
in this shell to the mean of the standard uncertainties of the
intensities of all reflections in the resolution shell.
The ratio of the mean of the intensities of the reflections
classified as 'observed' (see attribute observed_criterion) in category reflns in
this shell to the mean of the standard uncertainties of the
intensities of the 'observed' reflections in the resolution
shell.
The total number of reflections measured for this resolution
shell.
The number of reflections classified as 'observed'
(see attribute observed_criterion) in category reflns measured for this
resolution shell.
The number of unique reflections it is possible to measure in
this reflection shell.
The total number of measured reflections which are symmetrically
unique after merging for this resolution shell.
The total number of measured reflections classified as 'observed'
(see attribute observed_criterion) in category reflns which are symmetrically unique
after merging for this resolution shell.
R sym value in percent.
Chi-squared statistic for this resolution shell.
Redundancy for the current shell.
The percentage of geometrically possible reflections represented
by all reflections measured for this resolution shell.
The percentage of geometrically possible reflections represented
by reflections classified as 'observed' (see
attribute observed_criterion) in category reflns measured for this resolution shell.
The highest resolution in angstroms for the interplanar spacing
in the reflections in this shell. This is the smallest d value.
The lowest resolution in angstroms for the interplanar spacing
in the reflections in this shell. This is the largest d value.
Data items in the SOFTWARE category record details about
the software used in the structure analysis, which implied
any software used in the generation of any data items
associated with the structure determination and
structure representation.
These data items provide an alternative, and more thorough,
method for referencing computer programs than do data items
in the COMPUTING category.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:softwareCategory>
<PDBx:software name="Prolsq" version="unknown">
<PDBx:type>program</PDBx:type>
<PDBx:contact_author>Wayne A. Hendrickson</PDBx:contact_author>
<PDBx:location>ftp://rosebud.sdsc.edu/pub/sdsc/xtal/CCP4/ccp4/</PDBx:location>
<PDBx:classification>refinement</PDBx:classification>
<PDBx:citation_id>ref5</PDBx:citation_id>
<PDBx:language>Fortran</PDBx:language>
<PDBx:compiler_name>Convex Fortran</PDBx:compiler_name>
<PDBx:compiler_version>v8.0</PDBx:compiler_version>
<PDBx:hardware>Convex C220</PDBx:hardware>
<PDBx:os>ConvexOS</PDBx:os>
<PDBx:os_version>v10.1</PDBx:os_version>
<PDBx:dependencies>Requires that Protin be run first</PDBx:dependencies>
<PDBx:mods>optimized</PDBx:mods>
<PDBx:description>restrained least-squares refinement</PDBx:description>
</PDBx:software>
</PDBx:softwareCategory>
This data item is a pointer to attribute id in category citation in the CITATION
category.
The classification of the program according to its
major function.
data collection
data reduction
phasing
model building
refinement
validation
other
The compiler used to compile the software.
Convex Fortran
gcc
DEC C
The version of the compiler used to compile the software.
3.1
2.1 alpha
The recognized contact author of the software. This could be
the original author, modifier of the code, or maintainer, but
should be the individual most commonly associated with the
code.
T. Alwyn Jones
Axel Brunger
The email address of the attribute contact_author in category software.
bourne@sdsc.edu
The date the software was released.
1991-10-01
1990-04-30
Any prerequisite software required to run attribute name in category software.
PDBlib class library
Description of the software.
Uses method of restrained least squares
The hardware upon which the software was run.
Sun Sparc 10 model 41
Dec Alpha 3000 model 500S
Silicon Graphics Elan
Compaq PC 486/66
The major computing language in which the software is
coded.
An Internet address in the form of a URL describing
where details of the software can be found.
http://rosebud.sdsc.edu/projects/pb/IUCr/software.html
ftp://ftp.sdsc.edu/pub/sdsc/biology/
Any noteworthy modifications to the base software, if applicable.
Added support for space group F432
The name of the operating system under which the software
runs.
Ultrix
OpenVMS
DOS
Windows 95
Windows NT
Irix
HPUX
DEC Unix
The version of the operating system under which the software
runs.
3.1
4.2.1
The classification of the software according to the most
common types.
The name of the software.
Merlot
O
Xengen
X-plor
The version of the software.
v1.0
beta
3.1-2
unknown
Data items in the STRUCT category record details about the
description of the crystallographic structure.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:structCategory>
<PDBx:struct entry_id="5HVP">
<PDBx:title> HIV-1 protease complex with acetyl-pepstatin</PDBx:title>
</PDBx:struct>
</PDBx:structCategory>
An automatically generated descriptor for an NDB structure or
the unstructured content of the PDB COMPND record.
5'-D(*CP*GP*CP*(HYD)AP*AP*AP*TP*TP*TP*GP*CP*G)-3'
Text description of the methodology which produced this
model structure.
This model was produced from a 10 nanosecond Amber/MD simulation
starting from PDB structure ID 1ABC.
A title for the data block. The author should attempt to convey
the essence of the structure archived in the CIF in the title,
and to distinguish this structural result from others.
5'-D(*(I)CP*CP*GP*G)-3
T4 lysozyme mutant - S32A
hen egg white lysozyme at -30 degrees C
quail egg white lysozyme at 2 atmospheres
This data item is a pointer to attribute id in category entry in the ENTRY category.
Data items in the STRUCT_ASYM category record details about the
structural elements in the asymmetric unit.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:struct_asymCategory>
<PDBx:struct_asym id="A">
<PDBx:entity_id>1</PDBx:entity_id>
<PDBx:details>one monomer of the dimeric enzyme</PDBx:details>
</PDBx:struct_asym>
<PDBx:struct_asym id="B">
<PDBx:entity_id>1</PDBx:entity_id>
<PDBx:details>one monomer of the dimeric enzyme</PDBx:details>
</PDBx:struct_asym>
<PDBx:struct_asym id="C">
<PDBx:entity_id>2</PDBx:entity_id>
<PDBx:details>one partially occupied position for the inhibitor</PDBx:details>
</PDBx:struct_asym>
<PDBx:struct_asym id="D">
<PDBx:entity_id>2</PDBx:entity_id>
<PDBx:details>one partially occupied position for the inhibitor</PDBx:details>
</PDBx:struct_asym>
</PDBx:struct_asymCategory>
A description of special aspects of this portion of the contents
of the asymmetric unit.
The drug binds to this enzyme in two roughly
twofold symmetric modes. Hence this
biological unit (3) is roughly twofold
symmetric to biological unit (2). Disorder in
the protein chain indicated with alternative
id 2 should be used with this biological unit.
This data item is a pointer to attribute id in category entity in the ENTITY category.
A flag indicating that this entity was originally labeled
with a blank PDB chain id.
This data item indicates whether the structural elements are modified.
y
The value of attribute id in category struct_asym must uniquely identify a record in
the STRUCT_ASYM list.
Note that this item need not be a number; it can be any unique
identifier.
1
A
2B3
Data items in the STRUCT_BIOL category record details about
the structural elements that form each structure of biological
significance.
A given crystal structure may contain many different biological
structures. A given structural component in the asymmetric
unit may be part of more than one biological unit. A given
biological structure may involve crystallographic symmetry.
For instance, in a structure of a lysozyme-FAB structure, the
light and heavy chain components of the FAB could be one
biological unit, while the two chains of the FAB and the lysozyme
could constitute a second biological unit.
Example 1 - based on PDB entry 5HVP and laboratory records for the
structure corresponding to PDB entry 5HVP
<PDBx:struct_biolCategory>
<PDBx:struct_biol id="1">
<PDBx:details> significant deviations from twofold symmetry exist in this dimeric
enzyme</PDBx:details>
</PDBx:struct_biol>
<PDBx:struct_biol id="2">
<PDBx:details> The drug binds to this enzyme in two roughly twofold symmetric modes.
Hence this biological unit (2) is roughly twofold symmetric to biological
unit (3). Disorder in the protein chain indicated with alternative
id 1 should be used with this biological unit.</PDBx:details>
</PDBx:struct_biol>
<PDBx:struct_biol id="3">
<PDBx:details> The drug binds to this enzyme in two roughly twofold symmetric modes.
Hence this biological unit (3) is roughly twofold symmetric to biological
unit (2). Disorder in the protein chain indicated with alternative
id 2 should be used with this biological unit.</PDBx:details>
</PDBx:struct_biol>
</PDBx:struct_biolCategory>